BLASTX nr result
ID: Phellodendron21_contig00033280
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00033280 (387 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007416430.1 hypothetical protein MELLADRAFT_93707 [Melampsora... 58 3e-07 >XP_007416430.1 hypothetical protein MELLADRAFT_93707 [Melampsora larici-populina 98AG31] EGG00231.1 hypothetical protein MELLADRAFT_93707 [Melampsora larici-populina 98AG31] Length = 466 Score = 57.8 bits (138), Expect = 3e-07 Identities = 27/53 (50%), Positives = 34/53 (64%) Frame = -2 Query: 386 LLVAIQWASWSWSGIPGPLFAIGNCVQTFKLRTPVAEKHVAKQHVVLDSLHGV 228 LL+AIQWASWSW+GIPGPL A+ C+Q K + E V + V L SL + Sbjct: 398 LLIAIQWASWSWAGIPGPLLAMYTCIQACKPKPASIEPPVMDESVGLGSLSDI 450