BLASTX nr result
ID: Phellodendron21_contig00033257
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00033257 (312 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAU37167.1 Pentatricopeptide repeat-containing protein, chloropl... 83 1e-18 JAU81001.1 Pentatricopeptide repeat-containing protein, chloropl... 83 5e-18 JAU61618.1 Pentatricopeptide repeat-containing protein, chloropl... 83 5e-17 KDO65430.1 hypothetical protein CISIN_1g009782mg [Citrus sinensis] 84 1e-16 OMO85835.1 Adenylate kinase [Corchorus capsularis] 84 1e-16 XP_015389474.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 1e-16 XP_006413323.1 hypothetical protein EUTSA_v10024921mg [Eutrema s... 83 2e-16 XP_019089685.1 PREDICTED: pentatricopeptide repeat-containing pr... 83 2e-16 XP_010433660.2 PREDICTED: pentatricopeptide repeat-containing pr... 83 2e-16 XP_002867617.1 hypothetical protein ARALYDRAFT_354257 [Arabidops... 83 2e-16 XP_006421716.1 hypothetical protein CICLE_v10004726mg [Citrus cl... 82 4e-16 XP_006282784.1 hypothetical protein CARUB_v10006372mg, partial [... 82 4e-16 XP_018459285.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 82 6e-16 OAO96772.1 OTP70 [Arabidopsis thaliana] 82 6e-16 NP_194257.1 Tetratricopeptide repeat (TPR)-like superfamily prot... 82 6e-16 KZV38269.1 pentatricopeptide repeat-containing protein chloropla... 76 1e-15 XP_018472398.1 PREDICTED: pentatricopeptide repeat-containing pr... 81 1e-15 XP_013599657.1 PREDICTED: pentatricopeptide repeat-containing pr... 81 1e-15 XP_019088421.1 PREDICTED: pentatricopeptide repeat-containing pr... 81 1e-15 XP_013740191.1 PREDICTED: pentatricopeptide repeat-containing pr... 81 1e-15 >JAU37167.1 Pentatricopeptide repeat-containing protein, chloroplastic, partial [Noccaea caerulescens] Length = 105 Score = 83.2 bits (204), Expect = 1e-18 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = +1 Query: 1 DIGGIAARKLFELEPDNEHNFELLMRIYRNAGRSEDVERVERMLVDRGLE 150 DIG +AA++LFELEPDNEHNFELLMRIY A R+EDVERV +M+VDRGLE Sbjct: 55 DIGEVAAQRLFELEPDNEHNFELLMRIYSKAKRAEDVERVRQMMVDRGLE 104 >JAU81001.1 Pentatricopeptide repeat-containing protein, chloroplastic, partial [Noccaea caerulescens] Length = 164 Score = 83.2 bits (204), Expect = 5e-18 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = +1 Query: 1 DIGGIAARKLFELEPDNEHNFELLMRIYRNAGRSEDVERVERMLVDRGLE 150 DIG +AA++LFELEPDNEHNFELLMRIY A R+EDVERV +M+VDRGLE Sbjct: 114 DIGEVAAQRLFELEPDNEHNFELLMRIYSKAKRAEDVERVRQMMVDRGLE 163 >JAU61618.1 Pentatricopeptide repeat-containing protein, chloroplastic, partial [Noccaea caerulescens] Length = 291 Score = 83.2 bits (204), Expect = 5e-17 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = +1 Query: 1 DIGGIAARKLFELEPDNEHNFELLMRIYRNAGRSEDVERVERMLVDRGLE 150 DIG +AA++LFELEPDNEHNFELLMRIY A R+EDVERV +M+VDRGLE Sbjct: 241 DIGEVAAQRLFELEPDNEHNFELLMRIYSKAKRAEDVERVRQMMVDRGLE 290 >KDO65430.1 hypothetical protein CISIN_1g009782mg [Citrus sinensis] Length = 526 Score = 83.6 bits (205), Expect = 1e-16 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = +1 Query: 4 IGGIAARKLFELEPDNEHNFELLMRIYRNAGRSEDVERVERMLVDRGLE 150 +G AA+KLFELEPDNEHNFELL++IY NAGR +DVERVERMLVDRGLE Sbjct: 477 MGETAAQKLFELEPDNEHNFELLIKIYGNAGRLDDVERVERMLVDRGLE 525 >OMO85835.1 Adenylate kinase [Corchorus capsularis] Length = 743 Score = 83.6 bits (205), Expect = 1e-16 Identities = 40/49 (81%), Positives = 43/49 (87%) Frame = +1 Query: 1 DIGGIAARKLFELEPDNEHNFELLMRIYRNAGRSEDVERVERMLVDRGL 147 DIG IAAR LFELEPDNEHNFELLM+IY NAGR EDVERV M++DRGL Sbjct: 695 DIGEIAARNLFELEPDNEHNFELLMKIYSNAGRLEDVERVRTMMLDRGL 743 >XP_015389474.1 PREDICTED: pentatricopeptide repeat-containing protein At4g25270, chloroplastic-like isoform X2 [Citrus sinensis] Length = 773 Score = 83.6 bits (205), Expect = 1e-16 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = +1 Query: 4 IGGIAARKLFELEPDNEHNFELLMRIYRNAGRSEDVERVERMLVDRGLE 150 +G AA+KLFELEPDNEHNFELL++IY NAGR +DVERVERMLVDRGLE Sbjct: 724 MGETAAQKLFELEPDNEHNFELLIKIYGNAGRLDDVERVERMLVDRGLE 772 >XP_006413323.1 hypothetical protein EUTSA_v10024921mg [Eutrema salsugineum] ESQ54776.1 hypothetical protein EUTSA_v10024921mg [Eutrema salsugineum] Length = 523 Score = 83.2 bits (204), Expect = 2e-16 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = +1 Query: 1 DIGGIAARKLFELEPDNEHNFELLMRIYRNAGRSEDVERVERMLVDRGLE 150 DIG +AA++LFELEPDNEHNFELLMRIY A R+EDVERV +M+VDRGLE Sbjct: 473 DIGEVAAQRLFELEPDNEHNFELLMRIYSKAKRAEDVERVRQMMVDRGLE 522 >XP_019089685.1 PREDICTED: pentatricopeptide repeat-containing protein At4g25270, chloroplastic [Camelina sativa] Length = 527 Score = 82.8 bits (203), Expect = 2e-16 Identities = 38/50 (76%), Positives = 45/50 (90%) Frame = +1 Query: 1 DIGGIAARKLFELEPDNEHNFELLMRIYRNAGRSEDVERVERMLVDRGLE 150 DIG +AA++LFELEPDNEHNFELLMR+Y A R+EDVERV +M+VDRGLE Sbjct: 477 DIGEVAAQRLFELEPDNEHNFELLMRVYSKAKRAEDVERVRQMMVDRGLE 526 >XP_010433660.2 PREDICTED: pentatricopeptide repeat-containing protein At4g25270, chloroplastic-like [Camelina sativa] XP_010433661.2 PREDICTED: pentatricopeptide repeat-containing protein At4g25270, chloroplastic-like [Camelina sativa] Length = 567 Score = 82.8 bits (203), Expect = 2e-16 Identities = 38/50 (76%), Positives = 45/50 (90%) Frame = +1 Query: 1 DIGGIAARKLFELEPDNEHNFELLMRIYRNAGRSEDVERVERMLVDRGLE 150 DIG +AA++LFELEPDNEHNFELLMR+Y A R+EDVERV +M+VDRGLE Sbjct: 517 DIGEVAAQRLFELEPDNEHNFELLMRVYSKAKRAEDVERVRQMMVDRGLE 566 >XP_002867617.1 hypothetical protein ARALYDRAFT_354257 [Arabidopsis lyrata subsp. lyrata] EFH43876.1 hypothetical protein ARALYDRAFT_354257 [Arabidopsis lyrata subsp. lyrata] Length = 758 Score = 82.8 bits (203), Expect = 2e-16 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = +1 Query: 1 DIGGIAARKLFELEPDNEHNFELLMRIYRNAGRSEDVERVERMLVDRGLE 150 DIG ++A++LFELEPDNEHNFELLMRIY A R+EDVERV +MLVDRGLE Sbjct: 708 DIGEVSAQRLFELEPDNEHNFELLMRIYSKAKRAEDVERVRQMLVDRGLE 757 >XP_006421716.1 hypothetical protein CICLE_v10004726mg [Citrus clementina] ESR34956.1 hypothetical protein CICLE_v10004726mg [Citrus clementina] Length = 526 Score = 82.0 bits (201), Expect = 4e-16 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = +1 Query: 4 IGGIAARKLFELEPDNEHNFELLMRIYRNAGRSEDVERVERMLVDRGLE 150 +G AA+KLFELEPDNEHNFELL++IY N GR +DVERVERMLVDRGLE Sbjct: 477 MGETAAQKLFELEPDNEHNFELLIKIYGNGGRLDDVERVERMLVDRGLE 525 >XP_006282784.1 hypothetical protein CARUB_v10006372mg, partial [Capsella rubella] EOA15682.1 hypothetical protein CARUB_v10006372mg, partial [Capsella rubella] Length = 533 Score = 82.0 bits (201), Expect = 4e-16 Identities = 39/50 (78%), Positives = 44/50 (88%) Frame = +1 Query: 1 DIGGIAARKLFELEPDNEHNFELLMRIYRNAGRSEDVERVERMLVDRGLE 150 DIG +AA+ LFELEPDNEHNFELLMRIY A R+EDVERV +M+VDRGLE Sbjct: 483 DIGEVAAQHLFELEPDNEHNFELLMRIYSKAKRAEDVERVRQMMVDRGLE 532 >XP_018459285.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g25270, chloroplastic-like [Raphanus sativus] Length = 526 Score = 81.6 bits (200), Expect = 6e-16 Identities = 38/50 (76%), Positives = 44/50 (88%) Frame = +1 Query: 1 DIGGIAARKLFELEPDNEHNFELLMRIYRNAGRSEDVERVERMLVDRGLE 150 DIG +AA++LFELEPDNEHNFELLMRIY R+EDVERV +M+VDRGLE Sbjct: 476 DIGEVAAQRLFELEPDNEHNFELLMRIYSKVKRTEDVERVRQMMVDRGLE 525 >OAO96772.1 OTP70 [Arabidopsis thaliana] Length = 527 Score = 81.6 bits (200), Expect = 6e-16 Identities = 38/50 (76%), Positives = 45/50 (90%) Frame = +1 Query: 1 DIGGIAARKLFELEPDNEHNFELLMRIYRNAGRSEDVERVERMLVDRGLE 150 DIG +AA++LFELEPDNEHNFELL+RIY A R+EDVERV +M+VDRGLE Sbjct: 477 DIGEVAAQRLFELEPDNEHNFELLIRIYSKAKRAEDVERVRQMMVDRGLE 526 >NP_194257.1 Tetratricopeptide repeat (TPR)-like superfamily protein [Arabidopsis thaliana] Q9SB36.1 RecName: Full=Pentatricopeptide repeat-containing protein At4g25270, chloroplastic; Flags: Precursor CAA23068.1 putative protein [Arabidopsis thaliana] CAB81338.1 putative protein [Arabidopsis thaliana] AEE85033.1 Tetratricopeptide repeat (TPR)-like superfamily protein [Arabidopsis thaliana] Length = 527 Score = 81.6 bits (200), Expect = 6e-16 Identities = 38/50 (76%), Positives = 45/50 (90%) Frame = +1 Query: 1 DIGGIAARKLFELEPDNEHNFELLMRIYRNAGRSEDVERVERMLVDRGLE 150 DIG +AA++LFELEPDNEHNFELL+RIY A R+EDVERV +M+VDRGLE Sbjct: 477 DIGEVAAQRLFELEPDNEHNFELLIRIYSKAKRAEDVERVRQMMVDRGLE 526 >KZV38269.1 pentatricopeptide repeat-containing protein chloroplastic [Dorcoceras hygrometricum] Length = 112 Score = 75.9 bits (185), Expect = 1e-15 Identities = 34/51 (66%), Positives = 44/51 (86%) Frame = +1 Query: 1 DIGGIAARKLFELEPDNEHNFELLMRIYRNAGRSEDVERVERMLVDRGLEL 153 DIG IAA+ +FELEPD EHNFELLM+IYRN GR EDV+R++ +++RGL+L Sbjct: 62 DIGEIAAKHMFELEPDGEHNFELLMKIYRNLGRYEDVDRIKVAMMERGLDL 112 >XP_018472398.1 PREDICTED: pentatricopeptide repeat-containing protein At4g25270, chloroplastic-like [Raphanus sativus] XP_018472399.1 PREDICTED: pentatricopeptide repeat-containing protein At4g25270, chloroplastic-like [Raphanus sativus] Length = 526 Score = 80.9 bits (198), Expect = 1e-15 Identities = 38/50 (76%), Positives = 44/50 (88%) Frame = +1 Query: 1 DIGGIAARKLFELEPDNEHNFELLMRIYRNAGRSEDVERVERMLVDRGLE 150 DIG +AA++LFELEPDNEHNFELLMRIY A R +DVERV +M+VDRGLE Sbjct: 476 DIGEVAAQRLFELEPDNEHNFELLMRIYSKAKRVQDVERVRQMMVDRGLE 525 >XP_013599657.1 PREDICTED: pentatricopeptide repeat-containing protein At4g25270, chloroplastic [Brassica oleracea var. oleracea] Length = 526 Score = 80.9 bits (198), Expect = 1e-15 Identities = 38/50 (76%), Positives = 44/50 (88%) Frame = +1 Query: 1 DIGGIAARKLFELEPDNEHNFELLMRIYRNAGRSEDVERVERMLVDRGLE 150 DIG +AA++LFELEPDNEHNFELLMRIY A R +DVERV +M+VDRGLE Sbjct: 476 DIGEVAAQRLFELEPDNEHNFELLMRIYSKARRIQDVERVRQMMVDRGLE 525 >XP_019088421.1 PREDICTED: pentatricopeptide repeat-containing protein At4g25270, chloroplastic-like isoform X1 [Camelina sativa] XP_019088422.1 PREDICTED: pentatricopeptide repeat-containing protein At4g25270, chloroplastic-like isoform X1 [Camelina sativa] XP_019088423.1 PREDICTED: pentatricopeptide repeat-containing protein At4g25270, chloroplastic-like isoform X2 [Camelina sativa] Length = 527 Score = 80.9 bits (198), Expect = 1e-15 Identities = 38/50 (76%), Positives = 44/50 (88%) Frame = +1 Query: 1 DIGGIAARKLFELEPDNEHNFELLMRIYRNAGRSEDVERVERMLVDRGLE 150 DIG +AA++LFELEPDNEHNFELLMRIY A R+ DVERV +M+VDRGLE Sbjct: 477 DIGEVAAQRLFELEPDNEHNFELLMRIYSKAKRAADVERVRQMMVDRGLE 526 >XP_013740191.1 PREDICTED: pentatricopeptide repeat-containing protein At4g25270, chloroplastic [Brassica napus] XP_013736647.1 PREDICTED: pentatricopeptide repeat-containing protein At4g25270, chloroplastic [Brassica napus] CDX89428.1 BnaA01g14650D [Brassica napus] Length = 527 Score = 80.9 bits (198), Expect = 1e-15 Identities = 38/50 (76%), Positives = 44/50 (88%) Frame = +1 Query: 1 DIGGIAARKLFELEPDNEHNFELLMRIYRNAGRSEDVERVERMLVDRGLE 150 DIG +AA++LFELEPDNEHNFELLMRIY A R +DVERV +M+VDRGLE Sbjct: 477 DIGEVAAQRLFELEPDNEHNFELLMRIYSKAKRIQDVERVRQMMVDRGLE 526