BLASTX nr result
ID: Phellodendron21_contig00033254
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00033254 (358 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007409966.1 hypothetical protein MELLADRAFT_86141 [Melampsora... 91 8e-19 >XP_007409966.1 hypothetical protein MELLADRAFT_86141 [Melampsora larici-populina 98AG31] EGG07006.1 hypothetical protein MELLADRAFT_86141 [Melampsora larici-populina 98AG31] Length = 514 Score = 90.5 bits (223), Expect = 8e-19 Identities = 48/65 (73%), Positives = 53/65 (81%) Frame = -2 Query: 357 RTWIVQSDQQAKEEELGKDEELVDEYVEMIDEETGQKVKRLIQSRRRKSYTPKLKSGWGI 178 RTWIVQ+D Q EEELG+DEELVDEYVEMIDEETG+K+KRL QSRRRKS + K G G Sbjct: 442 RTWIVQADGQTNEEELGEDEELVDEYVEMIDEETGKKIKRLTQSRRRKSRSSGNK-GRGS 500 Query: 177 SHGRL 163 S GRL Sbjct: 501 SFGRL 505