BLASTX nr result
ID: Phellodendron21_contig00033233
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00033233 (418 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO60150.1 hypothetical protein CISIN_1g033826mg [Citrus sinensis] 56 2e-07 >KDO60150.1 hypothetical protein CISIN_1g033826mg [Citrus sinensis] Length = 111 Score = 55.8 bits (133), Expect = 2e-07 Identities = 25/45 (55%), Positives = 35/45 (77%) Frame = -2 Query: 417 MQKTIERYYKCTKERQSDKPEMDKYIHVRPLYLTINTVTMS*GKK 283 MQKT+ERYY+ T+ERQ D+ M++Y+ VRPLYL + T +S GK+ Sbjct: 62 MQKTLERYYRYTEERQIDRNGMERYMQVRPLYLNLITFEISLGKR 106