BLASTX nr result
ID: Phellodendron21_contig00033197
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00033197 (507 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018043107.1 ARF/SAR superfamily [Paraphaeosphaeria sporulosa]... 121 7e-32 KZM21722.1 GTP binding [Ascochyta rabiei] 121 7e-32 KKY23929.1 putative adp-ribosylation factor [Phaeomoniella chlam... 121 7e-32 XP_013271777.1 ADP-ribosylation factor [Rhinocladiella mackenzie... 121 7e-32 XP_007725373.1 ADP-ribosylation factor [Capronia coronata CBS 61... 121 7e-32 XP_007920061.1 hypothetical protein MYCFIDRAFT_49010 [Pseudocerc... 121 7e-32 XP_007672425.1 hypothetical protein BAUCODRAFT_61772 [Baudoinia ... 121 7e-32 XP_001797240.1 hypothetical protein SNOG_06879 [Parastagonospora... 121 7e-32 XP_007747463.1 ADP-ribosylation factor [Cladophialophora psammop... 119 4e-31 XP_007758701.1 ADP-ribosylation factor [Cladophialophora yegresi... 119 4e-31 GAM83579.1 hypothetical protein ANO11243_015670 [fungal sp. No.1... 119 6e-31 XP_013342756.1 hypothetical protein AUEXF2481DRAFT_5826 [Aureoba... 119 6e-31 XP_007692073.1 hypothetical protein COCMIDRAFT_106246 [Bipolaris... 119 6e-31 XP_003856771.1 hypothetical protein MYCGRDRAFT_102943 [Zymosepto... 119 6e-31 XP_018743759.1 ADP-ribosylation factor [Fusarium verticillioides... 117 2e-30 KOM20587.1 hypothetical protein XA68_2532 [Ophiocordyceps unilat... 118 2e-30 KKF95343.1 ADP-ribosylation factor [Ceratocystis platani] 117 5e-30 KIL95193.1 adp-ribosylation factor [Fusarium avenaceum] 117 5e-30 XP_003054231.1 predicted protein [Nectria haematococca mpVI 77-1... 117 5e-30 KJZ73544.1 ADP-ribosylation factor [Hirsutella minnesotensis 3608] 117 5e-30 >XP_018043107.1 ARF/SAR superfamily [Paraphaeosphaeria sporulosa] OAG12742.1 ARF/SAR superfamily [Paraphaeosphaeria sporulosa] Length = 183 Score = 121 bits (304), Expect = 7e-32 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = +2 Query: 2 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGHN 172 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGHN Sbjct: 127 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGHN 183 >KZM21722.1 GTP binding [Ascochyta rabiei] Length = 183 Score = 121 bits (304), Expect = 7e-32 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = +2 Query: 2 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGHN 172 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGHN Sbjct: 127 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGHN 183 >KKY23929.1 putative adp-ribosylation factor [Phaeomoniella chlamydospora] Length = 183 Score = 121 bits (304), Expect = 7e-32 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = +2 Query: 2 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGHN 172 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGHN Sbjct: 127 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGHN 183 >XP_013271777.1 ADP-ribosylation factor [Rhinocladiella mackenziei CBS 650.93] KIX04641.1 ADP-ribosylation factor [Rhinocladiella mackenziei CBS 650.93] Length = 183 Score = 121 bits (304), Expect = 7e-32 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = +2 Query: 2 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGHN 172 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGHN Sbjct: 127 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGHN 183 >XP_007725373.1 ADP-ribosylation factor [Capronia coronata CBS 617.96] XP_016238993.1 ADP-ribosylation factor [Exophiala spinifera] XP_016266682.1 ADP-ribosylation factor [Exophiala oligosperma] XP_016266683.1 ADP-ribosylation factor, variant [Exophiala oligosperma] EXJ85935.1 ADP-ribosylation factor [Capronia coronata CBS 617.96] KIW18777.1 ADP-ribosylation factor [Exophiala spinifera] KIW46466.1 ADP-ribosylation factor [Exophiala oligosperma] KIW46467.1 ADP-ribosylation factor, variant [Exophiala oligosperma] Length = 183 Score = 121 bits (304), Expect = 7e-32 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = +2 Query: 2 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGHN 172 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGHN Sbjct: 127 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGHN 183 >XP_007920061.1 hypothetical protein MYCFIDRAFT_49010 [Pseudocercospora fijiensis CIRAD86] XP_013258798.1 ADP-ribosylation factor [Exophiala aquamarina CBS 119918] XP_016220417.1 ADP-ribosylation factor [Exophiala mesophila] XP_016765310.1 ARF/SAR superfamily [Sphaerulina musiva SO2202] EME49550.1 hypothetical protein DOTSEDRAFT_143649 [Dothistroma septosporum NZE10] EME89405.1 hypothetical protein MYCFIDRAFT_49010 [Pseudocercospora fijiensis CIRAD86] EMF17189.1 ARF/SAR superfamily [Sphaerulina musiva SO2202] KEF56208.1 ADP-ribosylation factor [Exophiala aquamarina CBS 119918] KIV88843.1 ADP-ribosylation factor [Exophiala mesophila] KXS98110.1 hypothetical protein AC579_9005 [Pseudocercospora musae] KXT04391.1 hypothetical protein AC578_3632 [Mycosphaerella eumusae] Length = 183 Score = 121 bits (304), Expect = 7e-32 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = +2 Query: 2 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGHN 172 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGHN Sbjct: 127 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGHN 183 >XP_007672425.1 hypothetical protein BAUCODRAFT_61772 [Baudoinia panamericana UAMH 10762] XP_007734003.1 ADP-ribosylation factor [Capronia epimyces CBS 606.96] XP_008711040.1 ADP-ribosylation factor [Cyphellophora europaea CBS 101466] XP_009155958.1 ADP-ribosylation factor [Exophiala dermatitidis NIH/UT8656] XP_013313373.1 ADP-ribosylation factor [Exophiala xenobiotica] EHY55497.1 ADP-ribosylation factor [Exophiala dermatitidis NIH/UT8656] EMD01241.1 hypothetical protein BAUCODRAFT_61772 [Baudoinia panamericana UAMH 10762] ETN46328.1 ADP-ribosylation factor [Cyphellophora europaea CBS 101466] EXJ85018.1 ADP-ribosylation factor [Capronia epimyces CBS 606.96] KIV79416.1 ADP-ribosylation factor [Exophiala sideris] KIW52789.1 ADP-ribosylation factor [Exophiala xenobiotica] Length = 183 Score = 121 bits (304), Expect = 7e-32 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = +2 Query: 2 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGHN 172 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGHN Sbjct: 127 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGHN 183 >XP_001797240.1 hypothetical protein SNOG_06879 [Parastagonospora nodorum SN15] XP_001931217.1 ADP-ribosylation factor [Pyrenophora tritici-repentis Pt-1C-BFP] XP_003306107.1 hypothetical protein PTT_19141 [Pyrenophora teres f. teres 0-1] XP_003836109.1 similar to ADP-ribosylation factor [Leptosphaeria maculans JN3] XP_007586441.1 putative adp-ribosylation factor protein [Neofusicoccum parvum UCRNP2] XP_007782769.1 ADP-ribosylation factor [Coniosporium apollinis CBS 100218] XP_018387470.1 ARF/SAR superfamily [Alternaria alternata] XP_020134234.1 adp-ribosylation factor [Diplodia corticola] EAT85530.1 hypothetical protein SNOG_06879 [Parastagonospora nodorum SN15] EDU40322.1 ADP-ribosylation factor [Pyrenophora tritici-repentis Pt-1C-BFP] EFQ85784.1 hypothetical protein PTT_19141 [Pyrenophora teres f. teres 0-1] CBX92744.1 similar to ADP-ribosylation factor [Leptosphaeria maculans JN3] EKG11308.1 Ras small GTPase Rab type [Macrophomina phaseolina MS6] EOD46072.1 putative adp-ribosylation factor protein [Neofusicoccum parvum UCRNP2] EON67452.1 ADP-ribosylation factor [Coniosporium apollinis CBS 100218] KKY18488.1 putative adp-ribosylation factor [Diplodia seriata] OAG22049.1 ARF/SAR superfamily [Alternaria alternata] OAK98978.1 ARF/SAR superfamily [Stagonospora sp. SRC1lsM3a] OAL50675.1 ARF/SAR superfamily [Pyrenochaeta sp. DS3sAY3a] OCK82650.1 ARF/SAR superfamily protein [Lepidopterella palustris CBS 459.81] OCK97590.1 ARF/SAR superfamily protein [Cenococcum geophilum 1.58] OCL10497.1 ARF/SAR superfamily protein [Glonium stellatum] OJD38623.1 adp-ribosylation factor [Diplodia corticola] OMP88439.1 ADP-ribosylation factor [Diplodia seriata] Length = 183 Score = 121 bits (304), Expect = 7e-32 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = +2 Query: 2 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGHN 172 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGHN Sbjct: 127 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGHN 183 >XP_007747463.1 ADP-ribosylation factor [Cladophialophora psammophila CBS 110553] XP_013289398.1 ADP-ribosylation factor [Fonsecaea pedrosoi CBS 271.37] XP_016252348.1 ADP-ribosylation factor [Cladophialophora immunda] XP_016622052.1 ADP-ribosylation factor [Cladophialophora bantiana CBS 173.52] XP_016629739.1 ADP-ribosylation factor [Fonsecaea multimorphosa CBS 102226] EXJ68077.1 ADP-ribosylation factor [Cladophialophora psammophila CBS 110553] KIW32132.1 ADP-ribosylation factor [Cladophialophora immunda] KIW85590.1 ADP-ribosylation factor [Fonsecaea pedrosoi CBS 271.37] KIW95383.1 ADP-ribosylation factor [Cladophialophora bantiana CBS 173.52] KIX95616.1 ADP-ribosylation factor [Fonsecaea multimorphosa CBS 102226] OAG41712.1 ADP-ribosylation factor [Fonsecaea monophora] OAL21220.1 ADP-ribosylation factor [Fonsecaea multimorphosa] OAL23019.1 ADP-ribosylation factor [Fonsecaea nubica] Length = 183 Score = 119 bits (299), Expect = 4e-31 Identities = 56/57 (98%), Positives = 57/57 (100%) Frame = +2 Query: 2 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGHN 172 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGH+ Sbjct: 127 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGHS 183 >XP_007758701.1 ADP-ribosylation factor [Cladophialophora yegresii CBS 114405] XP_008728575.1 ADP-ribosylation factor [Cladophialophora carrionii CBS 160.54] XP_018693987.1 ADP-ribosylation factor [Fonsecaea erecta] ETI21958.1 ADP-ribosylation factor [Cladophialophora carrionii CBS 160.54] EXJ59078.1 ADP-ribosylation factor [Cladophialophora yegresii CBS 114405] KIW67680.1 ADP-ribosylation factor [Capronia semi-immersa] KXL44088.1 hypothetical protein FE78DRAFT_32967 [Acidomyces richmondensis] KYG49691.1 hypothetical protein M433DRAFT_58649 [Acidomyces richmondensis BFW] OAP60620.1 ADP-ribosylation factor [Fonsecaea erecta] Length = 183 Score = 119 bits (299), Expect = 4e-31 Identities = 56/57 (98%), Positives = 57/57 (100%) Frame = +2 Query: 2 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGHN 172 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGH+ Sbjct: 127 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGHS 183 >GAM83579.1 hypothetical protein ANO11243_015670 [fungal sp. No.11243] Length = 183 Score = 119 bits (298), Expect = 6e-31 Identities = 56/56 (100%), Positives = 56/56 (100%) Frame = +2 Query: 2 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGH 169 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGH Sbjct: 127 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGH 182 >XP_013342756.1 hypothetical protein AUEXF2481DRAFT_5826 [Aureobasidium subglaciale EXF-2481] XP_013428076.1 ARF/SAR superfamily [Aureobasidium namibiae CBS 147.97] KEQ60941.1 ARF/SAR superfamily [Aureobasidium melanogenum CBS 110374] KEQ73760.1 ARF/SAR superfamily [Aureobasidium namibiae CBS 147.97] KEQ84567.1 ARF/SAR superfamily [Aureobasidium pullulans EXF-150] KEQ94333.1 hypothetical protein AUEXF2481DRAFT_5826 [Aureobasidium subglaciale EXF-2481] OBW66378.1 Uncharacterized protein AUREO_035660 [Aureobasidium pullulans] Length = 183 Score = 119 bits (298), Expect = 6e-31 Identities = 56/56 (100%), Positives = 56/56 (100%) Frame = +2 Query: 2 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGH 169 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGH Sbjct: 127 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGH 182 >XP_007692073.1 hypothetical protein COCMIDRAFT_106246 [Bipolaris oryzae ATCC 44560] XP_007702994.1 hypothetical protein COCSADRAFT_96837 [Bipolaris sorokiniana ND90Pr] XP_007712825.1 hypothetical protein COCCADRAFT_97497 [Bipolaris zeicola 26-R-13] XP_008030030.1 hypothetical protein SETTUDRAFT_23174 [Setosphaeria turcica Et28A] XP_014082753.1 hypothetical protein COCC4DRAFT_129356 [Bipolaris maydis ATCC 48331] XP_014557718.1 hypothetical protein COCVIDRAFT_96243 [Bipolaris victoriae FI3] EMD61720.1 hypothetical protein COCSADRAFT_96837 [Bipolaris sorokiniana ND90Pr] EMD91399.1 hypothetical protein COCHEDRAFT_1135886 [Bipolaris maydis C5] ENI08844.1 hypothetical protein COCC4DRAFT_129356 [Bipolaris maydis ATCC 48331] EOA81914.1 hypothetical protein SETTUDRAFT_23174 [Setosphaeria turcica Et28A] EUC32898.1 hypothetical protein COCCADRAFT_97497 [Bipolaris zeicola 26-R-13] EUC41405.1 hypothetical protein COCMIDRAFT_106246 [Bipolaris oryzae ATCC 44560] EUN28113.1 hypothetical protein COCVIDRAFT_96243 [Bipolaris victoriae FI3] Length = 183 Score = 119 bits (298), Expect = 6e-31 Identities = 56/56 (100%), Positives = 56/56 (100%) Frame = +2 Query: 2 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGH 169 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGH Sbjct: 127 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGH 182 >XP_003856771.1 hypothetical protein MYCGRDRAFT_102943 [Zymoseptoria tritici IPO323] EGP91747.1 hypothetical protein MYCGRDRAFT_102943 [Zymoseptoria tritici IPO323] KJX95507.1 adp-ribosylation factor like protein [Zymoseptoria brevis] Length = 183 Score = 119 bits (298), Expect = 6e-31 Identities = 56/56 (100%), Positives = 56/56 (100%) Frame = +2 Query: 2 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGH 169 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGH Sbjct: 127 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGH 182 >XP_018743759.1 ADP-ribosylation factor [Fusarium verticillioides 7600] EWG37568.1 ADP-ribosylation factor [Fusarium verticillioides 7600] Length = 142 Score = 117 bits (292), Expect = 2e-30 Identities = 54/56 (96%), Positives = 56/56 (100%) Frame = +2 Query: 2 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGH 169 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWL+N+LRKAGH Sbjct: 86 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLANTLRKAGH 141 >KOM20587.1 hypothetical protein XA68_2532 [Ophiocordyceps unilateralis] Length = 186 Score = 118 bits (295), Expect = 2e-30 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = +2 Query: 2 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGH 169 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWL+NSLRKAGH Sbjct: 130 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLANSLRKAGH 185 >KKF95343.1 ADP-ribosylation factor [Ceratocystis platani] Length = 183 Score = 117 bits (292), Expect = 5e-30 Identities = 54/56 (96%), Positives = 56/56 (100%) Frame = +2 Query: 2 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGH 169 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWL+N+LRKAGH Sbjct: 127 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLANTLRKAGH 182 >KIL95193.1 adp-ribosylation factor [Fusarium avenaceum] Length = 183 Score = 117 bits (292), Expect = 5e-30 Identities = 54/56 (96%), Positives = 56/56 (100%) Frame = +2 Query: 2 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGH 169 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWL+N+LRKAGH Sbjct: 127 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLANTLRKAGH 182 >XP_003054231.1 predicted protein [Nectria haematococca mpVI 77-13-4] XP_009259988.1 hypothetical protein FPSE_08595 [Fusarium pseudograminearum CS3096] XP_011316767.1 hypothetical protein FGSG_01014 [Fusarium graminearum PH-1] XP_018232299.1 ADP-ribosylation factor [Fusarium oxysporum f. sp. lycopersici 4287] XP_018232300.1 ADP-ribosylation factor [Fusarium oxysporum f. sp. lycopersici 4287] XP_018743756.1 ADP-ribosylation factor [Fusarium verticillioides 7600] XP_018743757.1 ADP-ribosylation factor [Fusarium verticillioides 7600] XP_018743758.1 ADP-ribosylation factor [Fusarium verticillioides 7600] EEU48518.1 predicted protein [Nectria haematococca mpVI 77-13-4] EGU87300.1 hypothetical protein FOXB_02176 [Fusarium oxysporum Fo5176] EKJ71232.1 hypothetical protein FPSE_08595 [Fusarium pseudograminearum CS3096] EMT62092.1 ADP-ribosylation factor [Fusarium oxysporum f. sp. cubense race 4] ENH60865.1 ADP-ribosylation factor [Fusarium oxysporum f. sp. cubense race 1] CCT62268.1 probable ADP-ribosylation factor [Fusarium fujikuroi IMI 58289] ESU06282.1 hypothetical protein FGSG_01014 [Fusarium graminearum PH-1] EWG37565.1 ADP-ribosylation factor [Fusarium verticillioides 7600] EWG37566.1 ADP-ribosylation factor [Fusarium verticillioides 7600] EWG37567.1 ADP-ribosylation factor [Fusarium verticillioides 7600] EWY94083.1 ADP-ribosylation factor [Fusarium oxysporum FOSC 3-a] EWY94084.1 ADP-ribosylation factor [Fusarium oxysporum FOSC 3-a] EWZ50624.1 ADP-ribosylation factor [Fusarium oxysporum Fo47] EWZ50625.1 ADP-ribosylation factor [Fusarium oxysporum Fo47] EWZ91914.1 ADP-ribosylation factor [Fusarium oxysporum f. sp. lycopersici MN25] EXA53172.1 ADP-ribosylation factor [Fusarium oxysporum f. sp. pisi HDV247] EXA53173.1 ADP-ribosylation factor [Fusarium oxysporum f. sp. pisi HDV247] EXK47860.1 ADP-ribosylation factor [Fusarium oxysporum f. sp. melonis 26406] EXK47861.1 ADP-ribosylation factor [Fusarium oxysporum f. sp. melonis 26406] EXK89740.1 ADP-ribosylation factor [Fusarium oxysporum f. sp. raphani 54005] EXK89741.1 ADP-ribosylation factor [Fusarium oxysporum f. sp. raphani 54005] EXL49544.1 ADP-ribosylation factor [Fusarium oxysporum f. sp. radicis-lycopersici 26381] EXL49545.1 ADP-ribosylation factor [Fusarium oxysporum f. sp. radicis-lycopersici 26381] EXL80769.1 ADP-ribosylation factor [Fusarium oxysporum f. sp. conglutinans race 2 54008] EXL80770.1 ADP-ribosylation factor [Fusarium oxysporum f. sp. conglutinans race 2 54008] EXM11027.1 ADP-ribosylation factor [Fusarium oxysporum f. sp. cubense tropical race 4 54006] EXM11028.1 ADP-ribosylation factor [Fusarium oxysporum f. sp. cubense tropical race 4 54006] EXM24283.1 ADP-ribosylation factor [Fusarium oxysporum f. sp. vasinfectum 25433] EXM24284.1 ADP-ribosylation factor [Fusarium oxysporum f. sp. vasinfectum 25433] EYB33707.1 hypothetical protein FG05_01014 [Fusarium graminearum] CEF73074.1 unnamed protein product [Fusarium graminearum] KLO87398.1 putative ADP-ribosylation factor [Fusarium fujikuroi] KLP04957.1 putative ADP-ribosylation factor [Fusarium fujikuroi] KLP08791.1 putative ADP-ribosylation factor [Fusarium fujikuroi] KNA94253.1 ADP-ribosylation factor [Fusarium oxysporum f. sp. lycopersici 4287] KNA94254.1 ADP-ribosylation factor [Fusarium oxysporum f. sp. lycopersici 4287] KPA46586.1 adp-ribosylation factor [Fusarium langsethiae] OBS26837.1 hypothetical protein FPOA_00780 [Fusarium poae] CVK95650.1 probable ADP-ribosylation factor [Fusarium proliferatum] CZR34932.1 probable ADP-ribosylation factor [Fusarium proliferatum ET1] CVK83475.1 probable ADP-ribosylation factor [Fusarium mangiferae] Length = 183 Score = 117 bits (292), Expect = 5e-30 Identities = 54/56 (96%), Positives = 56/56 (100%) Frame = +2 Query: 2 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGH 169 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWL+N+LRKAGH Sbjct: 127 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLANTLRKAGH 182 >KJZ73544.1 ADP-ribosylation factor [Hirsutella minnesotensis 3608] Length = 186 Score = 117 bits (292), Expect = 5e-30 Identities = 54/57 (94%), Positives = 56/57 (98%) Frame = +2 Query: 2 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLSNSLRKAGHN 172 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWL+ +LRKAGHN Sbjct: 130 KQDLPNAMNAAEITDKLGLHSLRQRAWYIQSTCATSGDGLYEGLEWLATTLRKAGHN 186