BLASTX nr result
ID: Phellodendron21_contig00033196
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00033196 (391 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO69282.1 hypothetical protein CISIN_1g010197mg [Citrus sinensi... 62 1e-08 XP_006486469.1 PREDICTED: telomere repeat-binding protein 4 isof... 62 1e-08 XP_006486466.1 PREDICTED: telomere repeat-binding protein 4 isof... 62 1e-08 KDO69284.1 hypothetical protein CISIN_1g010197mg [Citrus sinensis] 57 6e-07 KDO69278.1 hypothetical protein CISIN_1g010197mg [Citrus sinensi... 57 6e-07 KDO69281.1 hypothetical protein CISIN_1g010197mg [Citrus sinensis] 57 6e-07 XP_006435552.1 hypothetical protein CICLE_v10030878mg [Citrus cl... 57 7e-07 XP_006486468.1 PREDICTED: telomere repeat-binding protein 4 isof... 57 7e-07 XP_006435551.1 hypothetical protein CICLE_v10030878mg [Citrus cl... 57 7e-07 XP_019240333.1 PREDICTED: telomere repeat-binding protein 3-like... 54 8e-06 >KDO69282.1 hypothetical protein CISIN_1g010197mg [Citrus sinensis] KDO69283.1 hypothetical protein CISIN_1g010197mg [Citrus sinensis] Length = 506 Score = 62.0 bits (149), Expect = 1e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +2 Query: 281 MKSKKKLDYGLNCFHVATIPKAPRSIRRRAQLKKADE 391 MKSKK+LD GL FHVATIPKAPRSIR++AQLKK DE Sbjct: 1 MKSKKRLDSGLKGFHVATIPKAPRSIRQKAQLKKPDE 37 >XP_006486469.1 PREDICTED: telomere repeat-binding protein 4 isoform X3 [Citrus sinensis] Length = 676 Score = 62.0 bits (149), Expect = 1e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +2 Query: 281 MKSKKKLDYGLNCFHVATIPKAPRSIRRRAQLKKADE 391 MKSKK+LD GL FHVATIPKAPRSIR++AQLKK DE Sbjct: 1 MKSKKRLDSGLKGFHVATIPKAPRSIRQKAQLKKPDE 37 >XP_006486466.1 PREDICTED: telomere repeat-binding protein 4 isoform X1 [Citrus sinensis] XP_006486467.1 PREDICTED: telomere repeat-binding protein 4 isoform X1 [Citrus sinensis] Length = 686 Score = 62.0 bits (149), Expect = 1e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +2 Query: 281 MKSKKKLDYGLNCFHVATIPKAPRSIRRRAQLKKADE 391 MKSKK+LD GL FHVATIPKAPRSIR++AQLKK DE Sbjct: 1 MKSKKRLDSGLKGFHVATIPKAPRSIRQKAQLKKPDE 37 >KDO69284.1 hypothetical protein CISIN_1g010197mg [Citrus sinensis] Length = 500 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +2 Query: 281 MKSKKKLDYGLNCFHVATIPKAPRSIRRRAQLKKADE 391 MKSKK+LD GL FHVATIPKAPRSI R+AQLKK DE Sbjct: 1 MKSKKRLDSGLKGFHVATIPKAPRSI-RKAQLKKPDE 36 >KDO69278.1 hypothetical protein CISIN_1g010197mg [Citrus sinensis] KDO69279.1 hypothetical protein CISIN_1g010197mg [Citrus sinensis] KDO69280.1 hypothetical protein CISIN_1g010197mg [Citrus sinensis] Length = 505 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +2 Query: 281 MKSKKKLDYGLNCFHVATIPKAPRSIRRRAQLKKADE 391 MKSKK+LD GL FHVATIPKAPRSI R+AQLKK DE Sbjct: 1 MKSKKRLDSGLKGFHVATIPKAPRSI-RKAQLKKPDE 36 >KDO69281.1 hypothetical protein CISIN_1g010197mg [Citrus sinensis] Length = 515 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +2 Query: 281 MKSKKKLDYGLNCFHVATIPKAPRSIRRRAQLKKADE 391 MKSKK+LD GL FHVATIPKAPRSI R+AQLKK DE Sbjct: 1 MKSKKRLDSGLKGFHVATIPKAPRSI-RKAQLKKPDE 36 >XP_006435552.1 hypothetical protein CICLE_v10030878mg [Citrus clementina] ESR48792.1 hypothetical protein CICLE_v10030878mg [Citrus clementina] Length = 675 Score = 57.0 bits (136), Expect = 7e-07 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +2 Query: 281 MKSKKKLDYGLNCFHVATIPKAPRSIRRRAQLKKADE 391 MKSKK+LD GL FHVATIPKAPRSI R+AQLKK DE Sbjct: 1 MKSKKRLDSGLKGFHVATIPKAPRSI-RKAQLKKPDE 36 >XP_006486468.1 PREDICTED: telomere repeat-binding protein 4 isoform X2 [Citrus sinensis] Length = 685 Score = 57.0 bits (136), Expect = 7e-07 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +2 Query: 281 MKSKKKLDYGLNCFHVATIPKAPRSIRRRAQLKKADE 391 MKSKK+LD GL FHVATIPKAPRSI R+AQLKK DE Sbjct: 1 MKSKKRLDSGLKGFHVATIPKAPRSI-RKAQLKKPDE 36 >XP_006435551.1 hypothetical protein CICLE_v10030878mg [Citrus clementina] ESR48791.1 hypothetical protein CICLE_v10030878mg [Citrus clementina] Length = 685 Score = 57.0 bits (136), Expect = 7e-07 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +2 Query: 281 MKSKKKLDYGLNCFHVATIPKAPRSIRRRAQLKKADE 391 MKSKK+LD GL FHVATIPKAPRSI R+AQLKK DE Sbjct: 1 MKSKKRLDSGLKGFHVATIPKAPRSI-RKAQLKKPDE 36 >XP_019240333.1 PREDICTED: telomere repeat-binding protein 3-like [Nicotiana attenuata] OIT20329.1 telomere repeat-binding protein 4 [Nicotiana attenuata] Length = 679 Score = 53.9 bits (128), Expect = 8e-06 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = +2 Query: 281 MKSKKKLDYGLNCFHVATIPKAPRSIRRRAQLKKADE 391 M SKKKLD+G N FHV IPKAPRS+RRR KK D+ Sbjct: 1 MVSKKKLDFGFNGFHVPFIPKAPRSVRRRGSCKKFDD 37