BLASTX nr result
ID: Phellodendron21_contig00033098
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00033098 (305 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAY22677.1 hypothetical protein MANES_18G017400 [Manihot esculenta] 74 2e-15 KJB09756.1 hypothetical protein B456_001G162300 [Gossypium raimo... 57 8e-08 >OAY22677.1 hypothetical protein MANES_18G017400 [Manihot esculenta] Length = 74 Score = 73.9 bits (180), Expect = 2e-15 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = +3 Query: 156 MNLENRARGLKTLPHSGPGALNWSFLSSLLPVSGEFPFS 272 MNLENRA GLKTLPHSGPGA NWSFLS L P+SGEFPFS Sbjct: 1 MNLENRAWGLKTLPHSGPGAFNWSFLSPLSPMSGEFPFS 39 >KJB09756.1 hypothetical protein B456_001G162300 [Gossypium raimondii] Length = 1286 Score = 57.0 bits (136), Expect(2) = 8e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +2 Query: 143 RETAHESRESSAGLEDPTAFRPRGPQLVLSLFSFT 247 R ++SRESS GLEDPTAFRPRG QLVLSLFSFT Sbjct: 1079 RRPMNQSRESSMGLEDPTAFRPRGLQLVLSLFSFT 1113 Score = 26.6 bits (57), Expect(2) = 8e-08 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 129 GSKIFARRPMN 161 GSKIFARRPMN Sbjct: 1073 GSKIFARRPMN 1083