BLASTX nr result
ID: Phellodendron21_contig00033089
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00033089 (256 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO54523.1 hypothetical protein CISIN_1g024645mg [Citrus sinensis] 71 7e-13 XP_006445554.1 hypothetical protein CICLE_v10016282mg [Citrus cl... 71 8e-13 XP_006445555.1 hypothetical protein CICLE_v10016282mg [Citrus cl... 71 8e-13 >KDO54523.1 hypothetical protein CISIN_1g024645mg [Citrus sinensis] Length = 261 Score = 70.9 bits (172), Expect = 7e-13 Identities = 36/43 (83%), Positives = 37/43 (86%) Frame = -2 Query: 129 IMRCCTCSCSCLSFALRLKDEIQTFLRDYDRLQYIAVILIYIQ 1 +MRCC C CS SFA RLKDEIQT LRDYDRLQYIAVILIYIQ Sbjct: 1 MMRCCWC-CSYSSFAHRLKDEIQTLLRDYDRLQYIAVILIYIQ 42 >XP_006445554.1 hypothetical protein CICLE_v10016282mg [Citrus clementina] XP_006488961.1 PREDICTED: uncharacterized protein LOC102628287 isoform X2 [Citrus sinensis] ESR58794.1 hypothetical protein CICLE_v10016282mg [Citrus clementina] KDO54520.1 hypothetical protein CISIN_1g024645mg [Citrus sinensis] Length = 264 Score = 70.9 bits (172), Expect = 8e-13 Identities = 36/43 (83%), Positives = 37/43 (86%) Frame = -2 Query: 129 IMRCCTCSCSCLSFALRLKDEIQTFLRDYDRLQYIAVILIYIQ 1 +MRCC C CS SFA RLKDEIQT LRDYDRLQYIAVILIYIQ Sbjct: 1 MMRCCWC-CSYSSFAHRLKDEIQTLLRDYDRLQYIAVILIYIQ 42 >XP_006445555.1 hypothetical protein CICLE_v10016282mg [Citrus clementina] XP_006488960.1 PREDICTED: uncharacterized protein LOC102628287 isoform X1 [Citrus sinensis] ESR58795.1 hypothetical protein CICLE_v10016282mg [Citrus clementina] KDO54521.1 hypothetical protein CISIN_1g024645mg [Citrus sinensis] Length = 265 Score = 70.9 bits (172), Expect = 8e-13 Identities = 36/43 (83%), Positives = 37/43 (86%) Frame = -2 Query: 129 IMRCCTCSCSCLSFALRLKDEIQTFLRDYDRLQYIAVILIYIQ 1 +MRCC C CS SFA RLKDEIQT LRDYDRLQYIAVILIYIQ Sbjct: 1 MMRCCWC-CSYSSFAHRLKDEIQTLLRDYDRLQYIAVILIYIQ 42