BLASTX nr result
ID: Phellodendron21_contig00033082
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00033082 (349 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006435469.1 hypothetical protein CICLE_v10000383mg [Citrus cl... 68 7e-11 >XP_006435469.1 hypothetical protein CICLE_v10000383mg [Citrus clementina] XP_006473867.1 PREDICTED: protein FAR1-RELATED SEQUENCE 5 [Citrus sinensis] ESR48709.1 hypothetical protein CICLE_v10000383mg [Citrus clementina] KDO85263.1 hypothetical protein CISIN_1g004450mg [Citrus sinensis] Length = 753 Score = 67.8 bits (164), Expect = 7e-11 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = +2 Query: 233 MEFEPLDIGNGVIEYDEVGNSNCEDDSEHPSDYNDHALP 349 MEFEPLDI NGVIE+DE+ NSN EDDSE PSDY DH LP Sbjct: 1 MEFEPLDIENGVIEFDEMRNSNGEDDSERPSDYYDHVLP 39