BLASTX nr result
ID: Phellodendron21_contig00033067
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00033067 (320 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007416744.1 hypothetical protein MELLADRAFT_68185 [Melampsora... 58 1e-07 >XP_007416744.1 hypothetical protein MELLADRAFT_68185 [Melampsora larici-populina 98AG31] EGF99997.1 hypothetical protein MELLADRAFT_68185 [Melampsora larici-populina 98AG31] Length = 571 Score = 58.2 bits (139), Expect = 1e-07 Identities = 32/66 (48%), Positives = 37/66 (56%) Frame = -2 Query: 205 HIDPYLVDPEASPPLGKIAFADAPLSSPGSQHSINPPPASIDPKSVDSNSQPSGSAKKGG 26 HIDPYL+D E SP LGK+AFADAP SSP S NP P P+ S KK Sbjct: 332 HIDPYLLDVETSPILGKLAFADAPRSSPSS----NPSPIQSPKPKPTQPKPPNESTKKTS 387 Query: 25 RARTST 8 + T+T Sbjct: 388 SSSTTT 393