BLASTX nr result
ID: Phellodendron21_contig00033033
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00033033 (275 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015897366.1 PREDICTED: probable ribosomal protein S11, mitoch... 68 9e-12 GAV74705.1 Ribosomal_S11 domain-containing protein [Cephalotus f... 65 9e-11 OIW07865.1 hypothetical protein TanjilG_19966 [Lupinus angustifo... 65 1e-10 XP_019449420.1 PREDICTED: probable ribosomal protein S11, mitoch... 65 1e-10 OAY41227.1 hypothetical protein MANES_09G083900 [Manihot esculenta] 64 3e-10 XP_010096239.1 hypothetical protein L484_026976 [Morus notabilis... 60 5e-10 XP_016542809.1 PREDICTED: probable ribosomal protein S11, mitoch... 63 5e-10 XP_003597842.2 ribosomal protein S11 [Medicago truncatula] AES68... 63 5e-10 CDP05448.1 unnamed protein product [Coffea canephora] 62 6e-10 CBI39423.3 unnamed protein product, partial [Vitis vinifera] 62 6e-10 XP_012066895.1 PREDICTED: probable ribosomal protein S11, mitoch... 63 6e-10 XP_002518786.1 PREDICTED: probable ribosomal protein S11, mitoch... 63 7e-10 XP_004489233.1 PREDICTED: probable ribosomal protein S11, mitoch... 63 8e-10 XP_013450760.1 ribosomal protein S11 [Medicago truncatula] AFK42... 63 8e-10 XP_018857385.1 PREDICTED: probable ribosomal protein S11, mitoch... 63 9e-10 XP_006445681.1 hypothetical protein CICLE_v10016360mg [Citrus cl... 63 9e-10 XP_016512756.1 PREDICTED: probable ribosomal protein S11, mitoch... 62 1e-09 XP_009780498.1 PREDICTED: uncharacterized protein LOC104229544 i... 62 1e-09 XP_016512755.1 PREDICTED: probable ribosomal protein S11, mitoch... 62 1e-09 XP_009780496.1 PREDICTED: uncharacterized protein LOC104229544 i... 62 1e-09 >XP_015897366.1 PREDICTED: probable ribosomal protein S11, mitochondrial [Ziziphus jujuba] Length = 261 Score = 68.2 bits (165), Expect = 9e-12 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 274 EGFANSRGDQDPIVHIEDTTRRPHNGCRLQKKRHI 170 EGF NSRGDQ+PIV+IEDTTRRPHNGCRL KKR I Sbjct: 227 EGFTNSRGDQNPIVYIEDTTRRPHNGCRLPKKRRI 261 >GAV74705.1 Ribosomal_S11 domain-containing protein [Cephalotus follicularis] Length = 250 Score = 65.5 bits (158), Expect = 9e-11 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -2 Query: 274 EGFANSRGDQDPIVHIEDTTRRPHNGCRLQKKRHI 170 EGF NSR DQ+PIV+IEDTTRRPHNGCRL KKR + Sbjct: 216 EGFTNSRSDQNPIVYIEDTTRRPHNGCRLPKKRRV 250 >OIW07865.1 hypothetical protein TanjilG_19966 [Lupinus angustifolius] Length = 232 Score = 65.1 bits (157), Expect = 1e-10 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -2 Query: 274 EGFANSRGDQDPIVHIEDTTRRPHNGCRLQKKRHI 170 EGFA+SRGD++PIV+IEDTTR+PHNGCRL KKR I Sbjct: 198 EGFADSRGDRNPIVYIEDTTRKPHNGCRLPKKRRI 232 >XP_019449420.1 PREDICTED: probable ribosomal protein S11, mitochondrial [Lupinus angustifolius] Length = 264 Score = 65.1 bits (157), Expect = 1e-10 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -2 Query: 274 EGFANSRGDQDPIVHIEDTTRRPHNGCRLQKKRHI 170 EGFA+SRGD++PIV+IEDTTR+PHNGCRL KKR I Sbjct: 230 EGFADSRGDRNPIVYIEDTTRKPHNGCRLPKKRRI 264 >OAY41227.1 hypothetical protein MANES_09G083900 [Manihot esculenta] Length = 260 Score = 64.3 bits (155), Expect = 3e-10 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -2 Query: 274 EGFANSRGDQDPIVHIEDTTRRPHNGCRLQKKRHI 170 EGF NSR D++PIV+IEDTTRRPHNGCRL KKR I Sbjct: 226 EGFCNSRADRNPIVYIEDTTRRPHNGCRLPKKRRI 260 >XP_010096239.1 hypothetical protein L484_026976 [Morus notabilis] EXB63634.1 hypothetical protein L484_026976 [Morus notabilis] Length = 81 Score = 60.1 bits (144), Expect = 5e-10 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -2 Query: 274 EGFANSRGDQDPIVHIEDTTRRPHNGCRLQKKR 176 EG+ NSR DQ+PIV+IEDTTR+PHNGCRL K+R Sbjct: 47 EGYTNSRTDQNPIVYIEDTTRKPHNGCRLPKRR 79 >XP_016542809.1 PREDICTED: probable ribosomal protein S11, mitochondrial [Capsicum annuum] Length = 233 Score = 63.2 bits (152), Expect = 5e-10 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -2 Query: 274 EGFANSRGDQDPIVHIEDTTRRPHNGCRLQKKRHI 170 EG+ +SRGD++P+V+IEDTTRRPHNGCRL KKR I Sbjct: 199 EGYTHSRGDKNPVVYIEDTTRRPHNGCRLPKKRRI 233 >XP_003597842.2 ribosomal protein S11 [Medicago truncatula] AES68093.2 ribosomal protein S11 [Medicago truncatula] Length = 238 Score = 63.2 bits (152), Expect = 5e-10 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -2 Query: 274 EGFANSRGDQDPIVHIEDTTRRPHNGCRLQKKRHI 170 EGF++SRGD++PIV+IEDTTRRPHNGCRL K R I Sbjct: 204 EGFSDSRGDKNPIVYIEDTTRRPHNGCRLPKSRRI 238 >CDP05448.1 unnamed protein product [Coffea canephora] Length = 153 Score = 61.6 bits (148), Expect = 6e-10 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = -2 Query: 274 EGFANSRGDQDPIVHIEDTTRRPHNGCRLQKKRHI 170 EGF RGDQ PIV+IEDTTRRPHNGCR KKR I Sbjct: 119 EGFTRGRGDQSPIVYIEDTTRRPHNGCRRPKKRRI 153 >CBI39423.3 unnamed protein product, partial [Vitis vinifera] Length = 155 Score = 61.6 bits (148), Expect = 6e-10 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = -2 Query: 274 EGFANSRGDQDPIVHIEDTTRRPHNGCRLQKKRHI 170 EGF +SRGD++PI++IEDTTRRPHNGCRL +KR + Sbjct: 121 EGFNSSRGDENPIMYIEDTTRRPHNGCRLPRKRRV 155 >XP_012066895.1 PREDICTED: probable ribosomal protein S11, mitochondrial [Jatropha curcas] KDP42317.1 hypothetical protein JCGZ_01641 [Jatropha curcas] Length = 253 Score = 63.2 bits (152), Expect = 6e-10 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 274 EGFANSRGDQDPIVHIEDTTRRPHNGCRLQKKR 176 EGF NSR DQ+PIV+IEDTTRRPHNGCRL K+R Sbjct: 219 EGFTNSRSDQNPIVYIEDTTRRPHNGCRLPKRR 251 >XP_002518786.1 PREDICTED: probable ribosomal protein S11, mitochondrial [Ricinus communis] EEF43711.1 Mitochondrial ribosomal protein S11, putative [Ricinus communis] Length = 226 Score = 62.8 bits (151), Expect = 7e-10 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -2 Query: 274 EGFANSRGDQDPIVHIEDTTRRPHNGCRLQKKRHI 170 EGF+NSR DQ+PIV+IED T+RPHNGCRL KKR I Sbjct: 192 EGFSNSRSDQNPIVYIEDVTQRPHNGCRLPKKRRI 226 >XP_004489233.1 PREDICTED: probable ribosomal protein S11, mitochondrial [Cicer arietinum] Length = 237 Score = 62.8 bits (151), Expect = 8e-10 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -2 Query: 274 EGFANSRGDQDPIVHIEDTTRRPHNGCRLQKKRHI 170 EGF +SRGD++PIV+IEDTTRRPHNGCRL K R I Sbjct: 203 EGFTDSRGDKNPIVYIEDTTRRPHNGCRLPKSRRI 237 >XP_013450760.1 ribosomal protein S11 [Medicago truncatula] AFK42065.1 unknown [Medicago truncatula] KEH24788.1 ribosomal protein S11 [Medicago truncatula] Length = 237 Score = 62.8 bits (151), Expect = 8e-10 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -2 Query: 274 EGFANSRGDQDPIVHIEDTTRRPHNGCRLQKKRHI 170 EGF +SRGD++PIV+IEDTTRRPHNGCRL K R I Sbjct: 203 EGFTDSRGDKNPIVYIEDTTRRPHNGCRLPKSRRI 237 >XP_018857385.1 PREDICTED: probable ribosomal protein S11, mitochondrial [Juglans regia] XP_018857386.1 PREDICTED: probable ribosomal protein S11, mitochondrial [Juglans regia] Length = 298 Score = 63.2 bits (152), Expect = 9e-10 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -2 Query: 274 EGFANSRGDQDPIVHIEDTTRRPHNGCRLQKKRHI 170 EGF NSRG Q+PIV++EDTTRRPHNGCRL K+R I Sbjct: 264 EGFTNSRGVQNPIVYVEDTTRRPHNGCRLPKRRRI 298 >XP_006445681.1 hypothetical protein CICLE_v10016360mg [Citrus clementina] XP_006485527.1 PREDICTED: probable ribosomal protein S11, mitochondrial [Citrus sinensis] ESR58921.1 hypothetical protein CICLE_v10016360mg [Citrus clementina] KDO52246.1 hypothetical protein CISIN_1g025294mg [Citrus sinensis] Length = 255 Score = 62.8 bits (151), Expect = 9e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 274 EGFANSRGDQDPIVHIEDTTRRPHNGCRLQKKRHI 170 EGFANSR DQ+PIV+IEDTTRRPHNGCRL KKR I Sbjct: 222 EGFANSR-DQNPIVYIEDTTRRPHNGCRLPKKRRI 255 >XP_016512756.1 PREDICTED: probable ribosomal protein S11, mitochondrial isoform X2 [Nicotiana tabacum] Length = 230 Score = 62.4 bits (150), Expect = 1e-09 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 274 EGFANSRGDQDPIVHIEDTTRRPHNGCRLQKKRHI 170 EG+ +SRGD++P+V IEDTTRRPHNGCRL KKR I Sbjct: 196 EGYTHSRGDKNPVVFIEDTTRRPHNGCRLSKKRRI 230 >XP_009780498.1 PREDICTED: uncharacterized protein LOC104229544 isoform X2 [Nicotiana sylvestris] Length = 230 Score = 62.4 bits (150), Expect = 1e-09 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 274 EGFANSRGDQDPIVHIEDTTRRPHNGCRLQKKRHI 170 EG+ +SRGD++P+V IEDTTRRPHNGCRL KKR I Sbjct: 196 EGYTHSRGDKNPVVFIEDTTRRPHNGCRLSKKRRI 230 >XP_016512755.1 PREDICTED: probable ribosomal protein S11, mitochondrial isoform X1 [Nicotiana tabacum] Length = 235 Score = 62.4 bits (150), Expect = 1e-09 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 274 EGFANSRGDQDPIVHIEDTTRRPHNGCRLQKKRHI 170 EG+ +SRGD++P+V IEDTTRRPHNGCRL KKR I Sbjct: 201 EGYTHSRGDKNPVVFIEDTTRRPHNGCRLSKKRRI 235 >XP_009780496.1 PREDICTED: uncharacterized protein LOC104229544 isoform X1 [Nicotiana sylvestris] XP_009780497.1 PREDICTED: uncharacterized protein LOC104229544 isoform X1 [Nicotiana sylvestris] Length = 235 Score = 62.4 bits (150), Expect = 1e-09 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 274 EGFANSRGDQDPIVHIEDTTRRPHNGCRLQKKRHI 170 EG+ +SRGD++P+V IEDTTRRPHNGCRL KKR I Sbjct: 201 EGYTHSRGDKNPVVFIEDTTRRPHNGCRLSKKRRI 235