BLASTX nr result
ID: Phellodendron21_contig00032940
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00032940 (493 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABN09902.1 VPS51/67 family protein, partial [Corchorus olitorius] 67 3e-12 OAY34174.1 hypothetical protein MANES_13G155600 [Manihot esculenta] 74 3e-12 OAY34175.1 hypothetical protein MANES_13G155600 [Manihot esculenta] 74 3e-12 XP_002514767.1 PREDICTED: conserved oligomeric Golgi complex sub... 73 6e-12 GAU40883.1 hypothetical protein TSUD_40580 [Trifolium subterraneum] 72 8e-12 XP_006468641.1 PREDICTED: conserved oligomeric Golgi complex sub... 72 8e-12 XP_006448515.1 hypothetical protein CICLE_v10014110mg [Citrus cl... 72 8e-12 KDO77084.1 hypothetical protein CISIN_1g001514mg [Citrus sinensis] 72 8e-12 GAV81921.1 Vps51 domain-containing protein [Cephalotus follicula... 72 1e-11 XP_011014591.1 PREDICTED: conserved oligomeric Golgi complex sub... 72 1e-11 XP_011011107.1 PREDICTED: conserved oligomeric Golgi complex sub... 72 1e-11 XP_012078918.1 PREDICTED: conserved oligomeric Golgi complex sub... 72 1e-11 XP_002311274.1 hypothetical protein POPTR_0008s07920g [Populus t... 72 1e-11 XP_002316166.2 hypothetical protein POPTR_0010s18470g [Populus t... 72 1e-11 XP_004496175.1 PREDICTED: conserved oligomeric Golgi complex sub... 71 2e-11 XP_018838025.1 PREDICTED: conserved oligomeric Golgi complex sub... 70 4e-11 XP_008218577.1 PREDICTED: LOW QUALITY PROTEIN: conserved oligome... 70 4e-11 XP_018838035.1 PREDICTED: conserved oligomeric Golgi complex sub... 70 4e-11 XP_016753987.1 PREDICTED: conserved oligomeric Golgi complex sub... 70 4e-11 XP_017615314.1 PREDICTED: conserved oligomeric Golgi complex sub... 70 4e-11 >ABN09902.1 VPS51/67 family protein, partial [Corchorus olitorius] Length = 57 Score = 67.4 bits (163), Expect = 3e-12 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +3 Query: 3 GQVGIFKDRSASAMSTFGDILPAQAAGLLSTFTATRADS 119 GQVGIFKDRSA+AMSTFGDILP QA G LS+FT TR+DS Sbjct: 19 GQVGIFKDRSAAAMSTFGDILPVQAGGFLSSFTTTRSDS 57 >OAY34174.1 hypothetical protein MANES_13G155600 [Manihot esculenta] Length = 1077 Score = 73.6 bits (179), Expect = 3e-12 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = +3 Query: 3 GQVGIFKDRSASAMSTFGDILPAQAAGLLSTFTATRADS 119 GQVGIFKDRSA+AMSTFGDILPAQAAGLLS+FTATR+DS Sbjct: 1039 GQVGIFKDRSAAAMSTFGDILPAQAAGLLSSFTATRSDS 1077 >OAY34175.1 hypothetical protein MANES_13G155600 [Manihot esculenta] Length = 1078 Score = 73.6 bits (179), Expect = 3e-12 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = +3 Query: 3 GQVGIFKDRSASAMSTFGDILPAQAAGLLSTFTATRADS 119 GQVGIFKDRSA+AMSTFGDILPAQAAGLLS+FTATR+DS Sbjct: 1040 GQVGIFKDRSAAAMSTFGDILPAQAAGLLSSFTATRSDS 1078 >XP_002514767.1 PREDICTED: conserved oligomeric Golgi complex subunit 1 [Ricinus communis] EEF47321.1 conserved hypothetical protein [Ricinus communis] Length = 1065 Score = 72.8 bits (177), Expect = 6e-12 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 3 GQVGIFKDRSASAMSTFGDILPAQAAGLLSTFTATRADS 119 GQVGIFKDRSA+AMSTFGDILPAQAAGLLS+FTATR DS Sbjct: 1027 GQVGIFKDRSAAAMSTFGDILPAQAAGLLSSFTATRLDS 1065 >GAU40883.1 hypothetical protein TSUD_40580 [Trifolium subterraneum] Length = 975 Score = 72.4 bits (176), Expect = 8e-12 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 3 GQVGIFKDRSASAMSTFGDILPAQAAGLLSTFTATRADS 119 GQVGIFKDRSA+AMSTFGDILPAQAAGLLS+FTA RADS Sbjct: 937 GQVGIFKDRSAAAMSTFGDILPAQAAGLLSSFTAPRADS 975 >XP_006468641.1 PREDICTED: conserved oligomeric Golgi complex subunit 1 [Citrus sinensis] Length = 1061 Score = 72.4 bits (176), Expect = 8e-12 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +3 Query: 3 GQVGIFKDRSASAMSTFGDILPAQAAGLLSTFTATRADS 119 GQVGIFKDRSASAMSTFGDILPAQAAGLLS+FT RADS Sbjct: 1023 GQVGIFKDRSASAMSTFGDILPAQAAGLLSSFTTARADS 1061 >XP_006448515.1 hypothetical protein CICLE_v10014110mg [Citrus clementina] ESR61755.1 hypothetical protein CICLE_v10014110mg [Citrus clementina] Length = 1062 Score = 72.4 bits (176), Expect = 8e-12 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +3 Query: 3 GQVGIFKDRSASAMSTFGDILPAQAAGLLSTFTATRADS 119 GQVGIFKDRSASAMSTFGDILPAQAAGLLS+FT RADS Sbjct: 1024 GQVGIFKDRSASAMSTFGDILPAQAAGLLSSFTTARADS 1062 >KDO77084.1 hypothetical protein CISIN_1g001514mg [Citrus sinensis] Length = 1063 Score = 72.4 bits (176), Expect = 8e-12 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +3 Query: 3 GQVGIFKDRSASAMSTFGDILPAQAAGLLSTFTATRADS 119 GQVGIFKDRSASAMSTFGDILPAQAAGLLS+FT RADS Sbjct: 1025 GQVGIFKDRSASAMSTFGDILPAQAAGLLSSFTTARADS 1063 >GAV81921.1 Vps51 domain-containing protein [Cephalotus follicularis] Length = 1059 Score = 72.0 bits (175), Expect = 1e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = +3 Query: 3 GQVGIFKDRSASAMSTFGDILPAQAAGLLSTFTATRADS 119 GQVGIFKDRS +AMSTFGDILPAQAAGLLS+FTATR+DS Sbjct: 1021 GQVGIFKDRSVAAMSTFGDILPAQAAGLLSSFTATRSDS 1059 >XP_011014591.1 PREDICTED: conserved oligomeric Golgi complex subunit 1-like [Populus euphratica] Length = 1071 Score = 72.0 bits (175), Expect = 1e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = +3 Query: 3 GQVGIFKDRSASAMSTFGDILPAQAAGLLSTFTATRADS 119 GQVGIFKDRSA+AMSTFGDILP QAAGLLS+FTATR+DS Sbjct: 1033 GQVGIFKDRSAAAMSTFGDILPVQAAGLLSSFTATRSDS 1071 >XP_011011107.1 PREDICTED: conserved oligomeric Golgi complex subunit 1-like [Populus euphratica] Length = 1071 Score = 72.0 bits (175), Expect = 1e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = +3 Query: 3 GQVGIFKDRSASAMSTFGDILPAQAAGLLSTFTATRADS 119 GQVGIFKDRSA+AMSTFGDILP QAAGLLS+FTATR+DS Sbjct: 1033 GQVGIFKDRSAAAMSTFGDILPVQAAGLLSSFTATRSDS 1071 >XP_012078918.1 PREDICTED: conserved oligomeric Golgi complex subunit 1 [Jatropha curcas] KDP32491.1 hypothetical protein JCGZ_13416 [Jatropha curcas] Length = 1071 Score = 72.0 bits (175), Expect = 1e-11 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = +3 Query: 3 GQVGIFKDRSASAMSTFGDILPAQAAGLLSTFTATRAD 116 GQVGIFKDRSA+AMSTFGDILPAQAAGLLS+FTATR+D Sbjct: 1033 GQVGIFKDRSAAAMSTFGDILPAQAAGLLSSFTATRSD 1070 >XP_002311274.1 hypothetical protein POPTR_0008s07920g [Populus trichocarpa] EEE88641.1 hypothetical protein POPTR_0008s07920g [Populus trichocarpa] Length = 1071 Score = 72.0 bits (175), Expect = 1e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = +3 Query: 3 GQVGIFKDRSASAMSTFGDILPAQAAGLLSTFTATRADS 119 GQVGIFKDRSA+AMSTFGDILP QAAGLLS+FTATR+DS Sbjct: 1033 GQVGIFKDRSAAAMSTFGDILPVQAAGLLSSFTATRSDS 1071 >XP_002316166.2 hypothetical protein POPTR_0010s18470g [Populus trichocarpa] EEF02337.2 hypothetical protein POPTR_0010s18470g [Populus trichocarpa] Length = 1071 Score = 72.0 bits (175), Expect = 1e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = +3 Query: 3 GQVGIFKDRSASAMSTFGDILPAQAAGLLSTFTATRADS 119 GQVGIFKDRSA+AMSTFGDILP QAAGLLS+FTATR+DS Sbjct: 1033 GQVGIFKDRSAAAMSTFGDILPVQAAGLLSSFTATRSDS 1071 >XP_004496175.1 PREDICTED: conserved oligomeric Golgi complex subunit 1 [Cicer arietinum] Length = 1060 Score = 71.2 bits (173), Expect = 2e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = +3 Query: 3 GQVGIFKDRSASAMSTFGDILPAQAAGLLSTFTATRADS 119 GQVGIFKDRSA+AMSTFGDILPAQAAGLLS+FTA R+DS Sbjct: 1021 GQVGIFKDRSAAAMSTFGDILPAQAAGLLSSFTAPRSDS 1059 >XP_018838025.1 PREDICTED: conserved oligomeric Golgi complex subunit 1-like [Juglans regia] Length = 582 Score = 70.5 bits (171), Expect = 4e-11 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +3 Query: 3 GQVGIFKDRSASAMSTFGDILPAQAAGLLSTFTATRADS 119 GQVGIFKDRSA+AMSTFGDILP QAAGLLS+FTA+R+DS Sbjct: 544 GQVGIFKDRSAAAMSTFGDILPVQAAGLLSSFTASRSDS 582 >XP_008218577.1 PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex subunit 1 [Prunus mume] Length = 1017 Score = 70.5 bits (171), Expect = 4e-11 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +3 Query: 3 GQVGIFKDRSASAMSTFGDILPAQAAGLLSTFTATRADS 119 GQVGIFKDRSA+AMSTFGDILPAQAAGLLS+FT +R+DS Sbjct: 979 GQVGIFKDRSAAAMSTFGDILPAQAAGLLSSFTTSRSDS 1017 >XP_018838035.1 PREDICTED: conserved oligomeric Golgi complex subunit 1 [Juglans regia] Length = 1055 Score = 70.5 bits (171), Expect = 4e-11 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +3 Query: 3 GQVGIFKDRSASAMSTFGDILPAQAAGLLSTFTATRADS 119 GQVGIFKDRSA+AMSTFGDILP QAAGLLS+FTA+R+DS Sbjct: 1017 GQVGIFKDRSAAAMSTFGDILPVQAAGLLSSFTASRSDS 1055 >XP_016753987.1 PREDICTED: conserved oligomeric Golgi complex subunit 1-like [Gossypium hirsutum] Length = 1064 Score = 70.5 bits (171), Expect = 4e-11 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +3 Query: 3 GQVGIFKDRSASAMSTFGDILPAQAAGLLSTFTATRADS 119 GQVGIFKDRSA+AMSTFGDILP QAAGLLS+FT TR+DS Sbjct: 1026 GQVGIFKDRSAAAMSTFGDILPVQAAGLLSSFTTTRSDS 1064 >XP_017615314.1 PREDICTED: conserved oligomeric Golgi complex subunit 1-like [Gossypium arboreum] KHG05841.1 Conserved oligomeric Golgi complex subunit 1 [Gossypium arboreum] Length = 1064 Score = 70.5 bits (171), Expect = 4e-11 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +3 Query: 3 GQVGIFKDRSASAMSTFGDILPAQAAGLLSTFTATRADS 119 GQVGIFKDRSA+AMSTFGDILP QAAGLLS+FT TR+DS Sbjct: 1026 GQVGIFKDRSAAAMSTFGDILPVQAAGLLSSFTTTRSDS 1064