BLASTX nr result
ID: Phellodendron21_contig00032772
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00032772 (442 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007416308.1 hypothetical protein MELLADRAFT_50387 [Melampsora... 55 5e-06 >XP_007416308.1 hypothetical protein MELLADRAFT_50387 [Melampsora larici-populina 98AG31] EGG00462.1 hypothetical protein MELLADRAFT_50387 [Melampsora larici-populina 98AG31] Length = 485 Score = 55.1 bits (131), Expect = 5e-06 Identities = 27/55 (49%), Positives = 34/55 (61%), Gaps = 3/55 (5%) Frame = +3 Query: 285 MCSRDAPATNGVGNHAV---SSPTLSSTHVIANATPMPLPLKAIEHTNPYAPRYA 440 MC + ATNG H V +SP L STHV +ATP P ++ + +NPYAPRYA Sbjct: 1 MCPTEINATNGTNGHKVDGLTSPNLDSTHVAIDATPAAAPQESHKQSNPYAPRYA 55