BLASTX nr result
ID: Phellodendron21_contig00032768
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00032768 (342 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006442895.1 hypothetical protein CICLE_v10021852mg [Citrus cl... 51 3e-11 KDO52440.1 hypothetical protein CISIN_1g025612mg [Citrus sinensis] 50 7e-11 XP_016550396.1 PREDICTED: pentatricopeptide repeat-containing pr... 41 1e-06 XP_010672285.1 PREDICTED: pentatricopeptide repeat-containing pr... 45 2e-06 OMO71109.1 hypothetical protein COLO4_28387 [Corchorus olitorius] 41 2e-06 KMT15823.1 hypothetical protein BVRB_3g057920 isoform B [Beta vu... 45 2e-06 XP_015902092.1 PREDICTED: pentatricopeptide repeat-containing pr... 47 2e-06 XP_015869106.1 PREDICTED: pentatricopeptide repeat-containing pr... 47 2e-06 OMO87959.1 hypothetical protein CCACVL1_08637 [Corchorus capsula... 40 5e-06 KZV18497.1 pentatricopeptide repeat-containing protein-like [Dor... 45 5e-06 XP_017619873.1 PREDICTED: pentatricopeptide repeat-containing pr... 40 7e-06 XP_016741855.1 PREDICTED: pentatricopeptide repeat-containing pr... 40 7e-06 XP_012478366.1 PREDICTED: pentatricopeptide repeat-containing pr... 40 9e-06 XP_016693579.1 PREDICTED: pentatricopeptide repeat-containing pr... 40 9e-06 >XP_006442895.1 hypothetical protein CICLE_v10021852mg [Citrus clementina] XP_006478807.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like [Citrus sinensis] ESR56135.1 hypothetical protein CICLE_v10021852mg [Citrus clementina] Length = 250 Score = 51.2 bits (121), Expect(2) = 3e-11 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +1 Query: 85 LKKFVYGMVCRLLKAGLLDTLIELRKQNELDLALKV 192 L++ +CRLLKA LLDTL ELR+QNELDLALKV Sbjct: 79 LEELFQSRICRLLKADLLDTLTELRRQNELDLALKV 114 Score = 44.3 bits (103), Expect(2) = 3e-11 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = +3 Query: 3 PMRRLSLLSSEAIQEVHAMKLANSSSELEEV 95 PM R +LSSEAIQ VHAMKLA SSS+LEE+ Sbjct: 52 PMWRSRVLSSEAIQAVHAMKLAKSSSKLEEL 82 >KDO52440.1 hypothetical protein CISIN_1g025612mg [Citrus sinensis] Length = 250 Score = 50.1 bits (118), Expect(2) = 7e-11 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = +1 Query: 109 VCRLLKAGLLDTLIELRKQNELDLALKV 192 +CRLLKA LLDTL ELR+QNELDLALKV Sbjct: 87 ICRLLKADLLDTLTELRRQNELDLALKV 114 Score = 43.9 bits (102), Expect(2) = 7e-11 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = +3 Query: 3 PMRRLSLLSSEAIQEVHAMKLANSSSELEE 92 PM R +LSSEAIQ VHAMKLA SSS+LEE Sbjct: 52 PMWRSRVLSSEAIQAVHAMKLAKSSSKLEE 81 >XP_016550396.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like [Capsicum annuum] Length = 294 Score = 40.8 bits (94), Expect(2) = 1e-06 Identities = 21/41 (51%), Positives = 29/41 (70%) Frame = +1 Query: 70 TQVPSLKKFVYGMVCRLLKAGLLDTLIELRKQNELDLALKV 192 T L++ + + RLLKA +LDTL EL++QNE+ LALKV Sbjct: 63 TSHDKLEEILKNKLSRLLKADVLDTLTELQRQNEVHLALKV 103 Score = 38.9 bits (89), Expect(2) = 1e-06 Identities = 19/31 (61%), Positives = 24/31 (77%) Frame = +3 Query: 3 PMRRLSLLSSEAIQEVHAMKLANSSSELEEV 95 PM R +LSSEAIQ VH++KLA S +LEE+ Sbjct: 41 PMWRSRVLSSEAIQAVHSVKLATSHDKLEEI 71 >XP_010672285.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like [Beta vulgaris subsp. vulgaris] Length = 256 Score = 45.1 bits (105), Expect(2) = 2e-06 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = +1 Query: 109 VCRLLKAGLLDTLIELRKQNELDLALKV 192 + RLLKA LLDTL EL++QNELDLALKV Sbjct: 94 IARLLKADLLDTLTELQRQNELDLALKV 121 Score = 33.9 bits (76), Expect(2) = 2e-06 Identities = 16/31 (51%), Positives = 24/31 (77%) Frame = +3 Query: 3 PMRRLSLLSSEAIQEVHAMKLANSSSELEEV 95 P+ R S LS+EAIQ V ++KLA S ++L++V Sbjct: 59 PLWRSSFLSTEAIQAVQSLKLAKSPAKLQQV 89 >OMO71109.1 hypothetical protein COLO4_28387 [Corchorus olitorius] Length = 232 Score = 41.2 bits (95), Expect(2) = 2e-06 Identities = 25/44 (56%), Positives = 29/44 (65%), Gaps = 4/44 (9%) Frame = +1 Query: 115 RLLKAGLLDTLIELRKQNELDLALKV----RLFHMGFCLFTLFQ 234 RLLKA LLDTL EL++QNE LALK+ R+ M LFT Q Sbjct: 78 RLLKADLLDTLAELQRQNEFHLALKLLGKNRMTEMAEQLFTQLQ 121 Score = 37.7 bits (86), Expect(2) = 2e-06 Identities = 18/31 (58%), Positives = 24/31 (77%) Frame = +3 Query: 3 PMRRLSLLSSEAIQEVHAMKLANSSSELEEV 95 P+ R +LS+EAIQ VH++KLANS+S L V Sbjct: 41 PLWRSRVLSTEAIQAVHSLKLANSNSRLHHV 71 >KMT15823.1 hypothetical protein BVRB_3g057920 isoform B [Beta vulgaris subsp. vulgaris] Length = 203 Score = 45.1 bits (105), Expect(2) = 2e-06 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = +1 Query: 109 VCRLLKAGLLDTLIELRKQNELDLALKV 192 + RLLKA LLDTL EL++QNELDLALKV Sbjct: 41 IARLLKADLLDTLTELQRQNELDLALKV 68 Score = 33.9 bits (76), Expect(2) = 2e-06 Identities = 16/31 (51%), Positives = 24/31 (77%) Frame = +3 Query: 3 PMRRLSLLSSEAIQEVHAMKLANSSSELEEV 95 P+ R S LS+EAIQ V ++KLA S ++L++V Sbjct: 6 PLWRSSFLSTEAIQAVQSLKLAKSPAKLQQV 36 >XP_015902092.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like [Ziziphus jujuba] Length = 252 Score = 46.6 bits (109), Expect(2) = 2e-06 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = +1 Query: 85 LKKFVYGMVCRLLKAGLLDTLIELRKQNELDLALKVRLF 201 L++ G V RLLKA LLD L ELR+QNELDLAL+V F Sbjct: 80 LEEVFNGRVARLLKADLLDALAELRRQNELDLALQVFKF 118 Score = 32.0 bits (71), Expect(2) = 2e-06 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 1/32 (3%) Frame = +3 Query: 3 PMRRLSLLSSEAIQEVHAMKLANSS-SELEEV 95 P+ R +LS+EAIQ V ++KLA S+ S+LEEV Sbjct: 52 PLWRSRVLSNEAIQAVQSLKLAKSNPSKLEEV 83 >XP_015869106.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like [Ziziphus jujuba] Length = 252 Score = 46.6 bits (109), Expect(2) = 2e-06 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = +1 Query: 85 LKKFVYGMVCRLLKAGLLDTLIELRKQNELDLALKVRLF 201 L++ G V RLLKA LLD L ELR+QNELDLAL+V F Sbjct: 80 LEEVFNGRVARLLKADLLDALAELRRQNELDLALQVFKF 118 Score = 32.0 bits (71), Expect(2) = 2e-06 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 1/32 (3%) Frame = +3 Query: 3 PMRRLSLLSSEAIQEVHAMKLANSS-SELEEV 95 P+ R +LS+EAIQ V ++KLA S+ S+LEEV Sbjct: 52 PLWRSRVLSNEAIQAVQSLKLAKSNPSKLEEV 83 >OMO87959.1 hypothetical protein CCACVL1_08637 [Corchorus capsularis] Length = 269 Score = 39.7 bits (91), Expect(2) = 5e-06 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = +1 Query: 115 RLLKAGLLDTLIELRKQNELDLALKV 192 RLLKA LLDTL EL++QNE LALKV Sbjct: 80 RLLKADLLDTLAELQRQNEFHLALKV 105 Score = 37.7 bits (86), Expect(2) = 5e-06 Identities = 18/31 (58%), Positives = 24/31 (77%) Frame = +3 Query: 3 PMRRLSLLSSEAIQEVHAMKLANSSSELEEV 95 P+ R +LS+EAIQ VH++KLANS+S L V Sbjct: 43 PLWRSRVLSTEAIQAVHSLKLANSNSRLHHV 73 >KZV18497.1 pentatricopeptide repeat-containing protein-like [Dorcoceras hygrometricum] Length = 266 Score = 45.1 bits (105), Expect(2) = 5e-06 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = +1 Query: 109 VCRLLKAGLLDTLIELRKQNELDLALKV 192 VCRLLK LLDTL EL++QNELDLAL+V Sbjct: 76 VCRLLKDDLLDTLAELQRQNELDLALQV 103 Score = 32.3 bits (72), Expect(2) = 5e-06 Identities = 16/31 (51%), Positives = 22/31 (70%) Frame = +3 Query: 3 PMRRLSLLSSEAIQEVHAMKLANSSSELEEV 95 P+ R +LS+EAIQ V ++KLA S+LE V Sbjct: 41 PLWRKHVLSTEAIQAVQSLKLAQDCSKLEHV 71 >XP_017619873.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like isoform X1 [Gossypium arboreum] Length = 249 Score = 40.0 bits (92), Expect(2) = 7e-06 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = +1 Query: 115 RLLKAGLLDTLIELRKQNELDLALKV 192 RLLKA LLDTL EL++QNE LALKV Sbjct: 81 RLLKADLLDTLAELQRQNEFQLALKV 106 Score = 37.0 bits (84), Expect(2) = 7e-06 Identities = 17/31 (54%), Positives = 25/31 (80%) Frame = +3 Query: 3 PMRRLSLLSSEAIQEVHAMKLANSSSELEEV 95 P+ + +LS+EAIQ VH++KLANS+S+L V Sbjct: 44 PLWKSRVLSTEAIQAVHSLKLANSNSKLHHV 74 >XP_016741855.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like [Gossypium hirsutum] XP_017619874.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like isoform X2 [Gossypium arboreum] Length = 243 Score = 40.0 bits (92), Expect(2) = 7e-06 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = +1 Query: 115 RLLKAGLLDTLIELRKQNELDLALKV 192 RLLKA LLDTL EL++QNE LALKV Sbjct: 81 RLLKADLLDTLAELQRQNEFQLALKV 106 Score = 37.0 bits (84), Expect(2) = 7e-06 Identities = 17/31 (54%), Positives = 25/31 (80%) Frame = +3 Query: 3 PMRRLSLLSSEAIQEVHAMKLANSSSELEEV 95 P+ + +LS+EAIQ VH++KLANS+S+L V Sbjct: 44 PLWKSRVLSTEAIQAVHSLKLANSNSKLHHV 74 >XP_012478366.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like [Gossypium raimondii] KJB29963.1 hypothetical protein B456_005G125600 [Gossypium raimondii] Length = 243 Score = 39.7 bits (91), Expect(2) = 9e-06 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = +1 Query: 115 RLLKAGLLDTLIELRKQNELDLALKV 192 RLLKA LLDTL EL++QNE LALKV Sbjct: 81 RLLKADLLDTLAELQRQNEFHLALKV 106 Score = 37.0 bits (84), Expect(2) = 9e-06 Identities = 17/31 (54%), Positives = 25/31 (80%) Frame = +3 Query: 3 PMRRLSLLSSEAIQEVHAMKLANSSSELEEV 95 P+ + +LS+EAIQ VH++KLANS+S+L V Sbjct: 44 PLWKSRVLSTEAIQAVHSLKLANSNSKLHHV 74 >XP_016693579.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like [Gossypium hirsutum] Length = 238 Score = 39.7 bits (91), Expect(2) = 9e-06 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = +1 Query: 115 RLLKAGLLDTLIELRKQNELDLALKV 192 RLLKA LLDTL EL++QNE LALKV Sbjct: 76 RLLKADLLDTLAELQRQNEFHLALKV 101 Score = 37.0 bits (84), Expect(2) = 9e-06 Identities = 17/31 (54%), Positives = 25/31 (80%) Frame = +3 Query: 3 PMRRLSLLSSEAIQEVHAMKLANSSSELEEV 95 P+ + +LS+EAIQ VH++KLANS+S+L V Sbjct: 39 PLWKSRVLSTEAIQAVHSLKLANSNSKLHHV 69