BLASTX nr result
ID: Phellodendron21_contig00032628
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00032628 (630 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHG04362.1 DEAD-box ATP-dependent RNA helicase 56 [Gossypium arb... 67 1e-09 >KHG04362.1 DEAD-box ATP-dependent RNA helicase 56 [Gossypium arboreum] Length = 301 Score = 67.0 bits (162), Expect = 1e-09 Identities = 34/55 (61%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = +2 Query: 467 LRGENSDERNLNSRMCIHL-HFVLDSINLRMVPNIIYCDICSFQPMEIYVDDEAK 628 L+G SD + C + HFVLDSI LR + N+IYC ICSFQPMEIYVDDEAK Sbjct: 3 LQGGKSDGPESQIKRCASIIHFVLDSIFLRKLANMIYCHICSFQPMEIYVDDEAK 57