BLASTX nr result
ID: Phellodendron21_contig00032613
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00032613 (358 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006446898.1 hypothetical protein CICLE_v10015032mg [Citrus cl... 93 2e-20 XP_006446899.1 hypothetical protein CICLE_v10015032mg [Citrus cl... 93 4e-20 XP_006468929.1 PREDICTED: calcium-binding mitochondrial carrier ... 93 8e-20 XP_006446900.1 hypothetical protein CICLE_v10015032mg [Citrus cl... 93 8e-20 XP_006446893.1 hypothetical protein CICLE_v10015524mg [Citrus cl... 90 3e-19 XP_006446894.1 hypothetical protein CICLE_v10015524mg [Citrus cl... 90 7e-19 XP_015893894.1 PREDICTED: calcium-binding mitochondrial carrier ... 88 7e-18 XP_018822038.1 PREDICTED: calcium-binding mitochondrial carrier ... 87 1e-17 KHN46834.1 Calcium-binding mitochondrial carrier protein SCaMC-3... 84 2e-17 XP_010066396.1 PREDICTED: calcium-binding mitochondrial carrier ... 86 2e-17 XP_016740167.1 PREDICTED: calcium-binding mitochondrial carrier ... 84 3e-17 ONI20092.1 hypothetical protein PRUPE_3G314500 [Prunus persica] 86 3e-17 XP_007151708.1 hypothetical protein PHAVU_004G069200g [Phaseolus... 86 3e-17 OAY37097.1 hypothetical protein MANES_11G074700 [Manihot esculenta] 86 3e-17 XP_007217350.1 hypothetical protein PRUPE_ppa021090mg [Prunus pe... 86 4e-17 ONI20088.1 hypothetical protein PRUPE_3G314500 [Prunus persica] ... 86 4e-17 XP_008231225.1 PREDICTED: calcium-binding mitochondrial carrier ... 86 4e-17 XP_009378058.1 PREDICTED: calcium-binding mitochondrial carrier ... 86 4e-17 XP_017437614.1 PREDICTED: calcium-binding mitochondrial carrier ... 85 6e-17 XP_007032054.2 PREDICTED: calcium-binding mitochondrial carrier ... 85 6e-17 >XP_006446898.1 hypothetical protein CICLE_v10015032mg [Citrus clementina] ESR60138.1 hypothetical protein CICLE_v10015032mg [Citrus clementina] Length = 316 Score = 93.2 bits (230), Expect = 2e-20 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -1 Query: 358 DVFKRTFKTEGLRGFYKGLFPNLLKVVPSASITYMVYEGMKKSLELE 218 DVFKRTFK+EGLRGFYKGLFPNLLKVVPSASITYMVYE MKKSLELE Sbjct: 270 DVFKRTFKSEGLRGFYKGLFPNLLKVVPSASITYMVYEAMKKSLELE 316 >XP_006446899.1 hypothetical protein CICLE_v10015032mg [Citrus clementina] ESR60139.1 hypothetical protein CICLE_v10015032mg [Citrus clementina] Length = 358 Score = 93.2 bits (230), Expect = 4e-20 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -1 Query: 358 DVFKRTFKTEGLRGFYKGLFPNLLKVVPSASITYMVYEGMKKSLELE 218 DVFKRTFK+EGLRGFYKGLFPNLLKVVPSASITYMVYE MKKSLELE Sbjct: 312 DVFKRTFKSEGLRGFYKGLFPNLLKVVPSASITYMVYEAMKKSLELE 358 >XP_006468929.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like [Citrus sinensis] Length = 490 Score = 93.2 bits (230), Expect = 8e-20 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -1 Query: 358 DVFKRTFKTEGLRGFYKGLFPNLLKVVPSASITYMVYEGMKKSLELE 218 DVFKRTFK+EGLRGFYKGLFPNLLKVVPSASITYMVYE MKKSLELE Sbjct: 444 DVFKRTFKSEGLRGFYKGLFPNLLKVVPSASITYMVYEAMKKSLELE 490 >XP_006446900.1 hypothetical protein CICLE_v10015032mg [Citrus clementina] ESR60140.1 hypothetical protein CICLE_v10015032mg [Citrus clementina] Length = 490 Score = 93.2 bits (230), Expect = 8e-20 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -1 Query: 358 DVFKRTFKTEGLRGFYKGLFPNLLKVVPSASITYMVYEGMKKSLELE 218 DVFKRTFK+EGLRGFYKGLFPNLLKVVPSASITYMVYE MKKSLELE Sbjct: 444 DVFKRTFKSEGLRGFYKGLFPNLLKVVPSASITYMVYEAMKKSLELE 490 >XP_006446893.1 hypothetical protein CICLE_v10015524mg [Citrus clementina] ESR60133.1 hypothetical protein CICLE_v10015524mg [Citrus clementina] Length = 317 Score = 90.1 bits (222), Expect = 3e-19 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = -1 Query: 358 DVFKRTFKTEGLRGFYKGLFPNLLKVVPSASITYMVYEGMKKSLELE 218 DVFKRTFK+EGLRGFYKGLF NLLKVVPSASITYMVYE MKKSLELE Sbjct: 270 DVFKRTFKSEGLRGFYKGLFSNLLKVVPSASITYMVYEAMKKSLELE 316 >XP_006446894.1 hypothetical protein CICLE_v10015524mg [Citrus clementina] ESR60134.1 hypothetical protein CICLE_v10015524mg [Citrus clementina] Length = 393 Score = 90.1 bits (222), Expect = 7e-19 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = -1 Query: 358 DVFKRTFKTEGLRGFYKGLFPNLLKVVPSASITYMVYEGMKKSLELE 218 DVFKRTFK+EGLRGFYKGLF NLLKVVPSASITYMVYE MKKSLELE Sbjct: 346 DVFKRTFKSEGLRGFYKGLFSNLLKVVPSASITYMVYEAMKKSLELE 392 >XP_015893894.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like isoform X1 [Ziziphus jujuba] XP_015893896.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like isoform X2 [Ziziphus jujuba] Length = 493 Score = 87.8 bits (216), Expect = 7e-18 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = -1 Query: 358 DVFKRTFKTEGLRGFYKGLFPNLLKVVPSASITYMVYEGMKKSLELE 218 DVF+RTFK EGLRGFYKG+FPNLLKVVPSASITY+VYE MKKSL+LE Sbjct: 447 DVFRRTFKHEGLRGFYKGIFPNLLKVVPSASITYLVYESMKKSLDLE 493 >XP_018822038.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like [Juglans regia] XP_018822039.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like [Juglans regia] Length = 493 Score = 87.0 bits (214), Expect = 1e-17 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = -1 Query: 358 DVFKRTFKTEGLRGFYKGLFPNLLKVVPSASITYMVYEGMKKSLELE 218 DVF+RTF+ EGLRGFYKGLFPNLLKVVPSASITYMVYE MKKSL+L+ Sbjct: 447 DVFRRTFQHEGLRGFYKGLFPNLLKVVPSASITYMVYESMKKSLDLD 493 >KHN46834.1 Calcium-binding mitochondrial carrier protein SCaMC-3 [Glycine soja] Length = 243 Score = 84.0 bits (206), Expect = 2e-17 Identities = 39/47 (82%), Positives = 44/47 (93%) Frame = -1 Query: 358 DVFKRTFKTEGLRGFYKGLFPNLLKVVPSASITYMVYEGMKKSLELE 218 DVF++T + EGLRGFYKG+FPNLLKVVPSASITYMVYE MKKSL+LE Sbjct: 197 DVFRKTLEHEGLRGFYKGIFPNLLKVVPSASITYMVYESMKKSLDLE 243 >XP_010066396.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 [Eucalyptus grandis] KCW64285.1 hypothetical protein EUGRSUZ_G01923 [Eucalyptus grandis] Length = 496 Score = 86.3 bits (212), Expect = 2e-17 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -1 Query: 358 DVFKRTFKTEGLRGFYKGLFPNLLKVVPSASITYMVYEGMKKSLELE 218 DVF+RTFK EGLRGFYKG+FPNLLKVVPSASITYMVYE MKK L+LE Sbjct: 450 DVFRRTFKHEGLRGFYKGIFPNLLKVVPSASITYMVYETMKKRLQLE 496 >XP_016740167.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like [Gossypium hirsutum] Length = 282 Score = 84.3 bits (207), Expect = 3e-17 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = -1 Query: 358 DVFKRTFKTEGLRGFYKGLFPNLLKVVPSASITYMVYEGMKKSLELE 218 DVF RTF+ EG RGFYKGLFPNLLKVVP+ASITY+VYE MKKSLELE Sbjct: 236 DVFWRTFRNEGCRGFYKGLFPNLLKVVPAASITYLVYEAMKKSLELE 282 >ONI20092.1 hypothetical protein PRUPE_3G314500 [Prunus persica] Length = 387 Score = 85.5 bits (210), Expect = 3e-17 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -1 Query: 358 DVFKRTFKTEGLRGFYKGLFPNLLKVVPSASITYMVYEGMKKSLEL 221 DVF+RTF+ EGLRGFYKG+FPNLLKVVPSASITYMVYE MKKSL+L Sbjct: 341 DVFRRTFQHEGLRGFYKGIFPNLLKVVPSASITYMVYESMKKSLDL 386 >XP_007151708.1 hypothetical protein PHAVU_004G069200g [Phaseolus vulgaris] ESW23702.1 hypothetical protein PHAVU_004G069200g [Phaseolus vulgaris] Length = 479 Score = 85.9 bits (211), Expect = 3e-17 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = -1 Query: 358 DVFKRTFKTEGLRGFYKGLFPNLLKVVPSASITYMVYEGMKKSLELE 218 DVF+RTF+ EGLRGFYKGLFPNLLKVVPSASITY+VYE MKK L+LE Sbjct: 433 DVFRRTFRYEGLRGFYKGLFPNLLKVVPSASITYLVYENMKKGLDLE 479 >OAY37097.1 hypothetical protein MANES_11G074700 [Manihot esculenta] Length = 495 Score = 85.9 bits (211), Expect = 3e-17 Identities = 39/47 (82%), Positives = 45/47 (95%) Frame = -1 Query: 358 DVFKRTFKTEGLRGFYKGLFPNLLKVVPSASITYMVYEGMKKSLELE 218 DVF+RTF+ EG+RGFYKG+FPN+LKVVPSASITYMVYE MKKSL+LE Sbjct: 449 DVFRRTFQHEGIRGFYKGIFPNMLKVVPSASITYMVYEAMKKSLDLE 495 >XP_007217350.1 hypothetical protein PRUPE_ppa021090mg [Prunus persica] Length = 465 Score = 85.5 bits (210), Expect = 4e-17 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -1 Query: 358 DVFKRTFKTEGLRGFYKGLFPNLLKVVPSASITYMVYEGMKKSLEL 221 DVF+RTF+ EGLRGFYKG+FPNLLKVVPSASITYMVYE MKKSL+L Sbjct: 419 DVFRRTFQHEGLRGFYKGIFPNLLKVVPSASITYMVYESMKKSLDL 464 >ONI20088.1 hypothetical protein PRUPE_3G314500 [Prunus persica] ONI20089.1 hypothetical protein PRUPE_3G314500 [Prunus persica] ONI20090.1 hypothetical protein PRUPE_3G314500 [Prunus persica] ONI20091.1 hypothetical protein PRUPE_3G314500 [Prunus persica] Length = 495 Score = 85.5 bits (210), Expect = 4e-17 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -1 Query: 358 DVFKRTFKTEGLRGFYKGLFPNLLKVVPSASITYMVYEGMKKSLEL 221 DVF+RTF+ EGLRGFYKG+FPNLLKVVPSASITYMVYE MKKSL+L Sbjct: 449 DVFRRTFQHEGLRGFYKGIFPNLLKVVPSASITYMVYESMKKSLDL 494 >XP_008231225.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like isoform X1 [Prunus mume] XP_008231226.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like isoform X1 [Prunus mume] XP_016649539.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like isoform X1 [Prunus mume] Length = 495 Score = 85.5 bits (210), Expect = 4e-17 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -1 Query: 358 DVFKRTFKTEGLRGFYKGLFPNLLKVVPSASITYMVYEGMKKSLEL 221 DVF+RTF+ EGLRGFYKG+FPNLLKVVPSASITYMVYE MKKSL+L Sbjct: 449 DVFRRTFQHEGLRGFYKGIFPNLLKVVPSASITYMVYESMKKSLDL 494 >XP_009378058.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like isoform X1 [Pyrus x bretschneideri] XP_009378059.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like isoform X1 [Pyrus x bretschneideri] Length = 497 Score = 85.5 bits (210), Expect = 4e-17 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -1 Query: 358 DVFKRTFKTEGLRGFYKGLFPNLLKVVPSASITYMVYEGMKKSLEL 221 DVF+RTF+ EGLRGFYKG+FPNLLKVVPSASITYMVYE MKKSL+L Sbjct: 451 DVFRRTFQHEGLRGFYKGIFPNLLKVVPSASITYMVYESMKKSLDL 496 >XP_017437614.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like [Vigna angularis] KOM55818.1 hypothetical protein LR48_Vigan10g171000 [Vigna angularis] BAU01748.1 hypothetical protein VIGAN_11104600 [Vigna angularis var. angularis] Length = 479 Score = 85.1 bits (209), Expect = 6e-17 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = -1 Query: 358 DVFKRTFKTEGLRGFYKGLFPNLLKVVPSASITYMVYEGMKKSLELE 218 DVF+RTFK EGLRGFYKGLFPNLLKVVP+ASITY+VYE MKK L+LE Sbjct: 433 DVFRRTFKHEGLRGFYKGLFPNLLKVVPAASITYLVYEHMKKGLDLE 479 >XP_007032054.2 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 isoform X1 [Theobroma cacao] Length = 496 Score = 85.1 bits (209), Expect = 6e-17 Identities = 39/47 (82%), Positives = 45/47 (95%) Frame = -1 Query: 358 DVFKRTFKTEGLRGFYKGLFPNLLKVVPSASITYMVYEGMKKSLELE 218 D+FKRTF+ EG+RGFYKGLFPNLLKVVPSASITY+VYE MK+SL+LE Sbjct: 450 DMFKRTFQHEGIRGFYKGLFPNLLKVVPSASITYLVYESMKRSLDLE 496