BLASTX nr result
ID: Phellodendron21_contig00032460
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00032460 (351 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO58903.1 hypothetical protein CISIN_1g0190022mg, partial [Citr... 54 2e-06 >KDO58903.1 hypothetical protein CISIN_1g0190022mg, partial [Citrus sinensis] Length = 249 Score = 54.3 bits (129), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 134 TQAESMVSEIHLKEKEFETLNGLWRRIQGSN 226 TQAE +VSEIHLKEKE ETLNGL RRI+GSN Sbjct: 150 TQAEGLVSEIHLKEKELETLNGLRRRIEGSN 180