BLASTX nr result
ID: Phellodendron21_contig00032397
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00032397 (401 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007414323.1 hypothetical protein MELLADRAFT_91428 [Melampsora... 96 1e-20 >XP_007414323.1 hypothetical protein MELLADRAFT_91428 [Melampsora larici-populina 98AG31] EGG02338.1 hypothetical protein MELLADRAFT_91428 [Melampsora larici-populina 98AG31] Length = 929 Score = 96.3 bits (238), Expect = 1e-20 Identities = 55/109 (50%), Positives = 68/109 (62%), Gaps = 6/109 (5%) Frame = -3 Query: 375 YQPPGRRTGADARP-SALARKGSLVGRK-LEVPGPSRSTKRVTFAEDPVQSRYVYEVEE- 205 YQPPGRRT +D +P S L K SL+G K E+P R KRVTFAE+P ++R V E Sbjct: 818 YQPPGRRTVSDPKPTSLLIHKRSLIGAKSTELPAAPRGYKRVTFAEEPARARRVVSYGET 877 Query: 204 ---EKPLTKPILSAQIAMNRLREAALMERLSVLARNHPNLLSDDTAWKV 67 E+ + S IAM RLREA RLSVL+ NHPNLL +D+AW + Sbjct: 878 DDGEERAAPRVTSVDIAMERLREAGAPRRLSVLSNNHPNLLGEDSAWMI 926