BLASTX nr result
ID: Phellodendron21_contig00032343
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00032343 (497 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006472509.1 PREDICTED: cyclin-D4-1-like [Citrus sinensis] 53 1e-07 XP_006433861.1 hypothetical protein CICLE_v10001581mg [Citrus cl... 51 4e-07 >XP_006472509.1 PREDICTED: cyclin-D4-1-like [Citrus sinensis] Length = 366 Score = 52.8 bits (125), Expect(2) = 1e-07 Identities = 29/52 (55%), Positives = 34/52 (65%), Gaps = 2/52 (3%) Frame = +1 Query: 103 INCSMTGS*PKRRRCSSV--SLPQSLIGLLDAACLSYKSSETAAGLCANPSH 252 IN S+ G K +S+ S PQS IG+LDAACLSYKS E+ G CAN SH Sbjct: 297 INDSLIGGSVKSATSASLATSFPQSPIGVLDAACLSYKSDESTVGSCANSSH 348 Score = 30.4 bits (67), Expect(2) = 1e-07 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 258 KRRKLNTPYEVEL 296 KRRKLNTPYEVEL Sbjct: 354 KRRKLNTPYEVEL 366 >XP_006433861.1 hypothetical protein CICLE_v10001581mg [Citrus clementina] ESR47101.1 hypothetical protein CICLE_v10001581mg [Citrus clementina] Length = 366 Score = 50.8 bits (120), Expect(2) = 4e-07 Identities = 23/34 (67%), Positives = 26/34 (76%) Frame = +1 Query: 151 SVSLPQSLIGLLDAACLSYKSSETAAGLCANPSH 252 + S PQS IG+LDAACLSYKS E+ G CAN SH Sbjct: 315 ATSFPQSPIGVLDAACLSYKSDESTVGSCANSSH 348 Score = 30.4 bits (67), Expect(2) = 4e-07 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 258 KRRKLNTPYEVEL 296 KRRKLNTPYEVEL Sbjct: 354 KRRKLNTPYEVEL 366