BLASTX nr result
ID: Phellodendron21_contig00032338
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00032338 (416 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007417103.1 hypothetical protein MELLADRAFT_94214 [Melampsora... 71 1e-11 >XP_007417103.1 hypothetical protein MELLADRAFT_94214 [Melampsora larici-populina 98AG31] EGF99645.1 hypothetical protein MELLADRAFT_94214 [Melampsora larici-populina 98AG31] Length = 2065 Score = 71.2 bits (173), Expect = 1e-11 Identities = 37/63 (58%), Positives = 45/63 (71%) Frame = -1 Query: 413 SEGEDAFSGRVDDGSKSLQSVSAKACPVATDARVEYQLERLTQTWAELSDMVKDRHASTT 234 SE ++ FS + +K L+ VS KAC V D RVEYQLERLTQTWAELS+MVKDR S Sbjct: 1723 SEDDELFSVNQESETK-LKEVSLKACGVGNDGRVEYQLERLTQTWAELSEMVKDRQESKD 1781 Query: 233 EPS 225 +P+ Sbjct: 1782 DPN 1784