BLASTX nr result
ID: Phellodendron21_contig00032330
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00032330 (517 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015389776.1 PREDICTED: zinc finger BED domain-containing prot... 69 4e-11 XP_019056059.1 PREDICTED: zinc finger BED domain-containing prot... 66 2e-10 KZV55410.1 hypothetical protein F511_06460, partial [Dorcoceras ... 66 7e-10 KZV42483.1 hypothetical protein F511_36149, partial [Dorcoceras ... 65 8e-10 XP_019074902.1 PREDICTED: zinc finger BED domain-containing prot... 63 2e-09 XP_010649234.2 PREDICTED: zinc finger BED domain-containing prot... 63 2e-09 GAV91543.1 Dimer_Tnp_hAT domain-containing protein/DUF4413 domai... 65 2e-09 OMO58912.1 putative Zinc finger, BED-type [Corchorus capsularis] 65 3e-09 XP_015877255.1 PREDICTED: zinc finger BED domain-containing prot... 62 4e-09 CAN78054.1 hypothetical protein VITISV_017198 [Vitis vinifera] 64 7e-09 KZV18122.1 hypothetical protein F511_25448 [Dorcoceras hygrometr... 61 8e-09 KZV22693.1 hypothetical protein F511_05325 [Dorcoceras hygrometr... 64 1e-08 BAT75705.1 hypothetical protein VIGAN_01361400 [Vigna angularis ... 59 1e-08 XP_010655772.1 PREDICTED: zinc finger BED domain-containing prot... 62 1e-08 XP_016514801.1 PREDICTED: zinc finger BED domain-containing prot... 60 2e-08 CAN83599.1 hypothetical protein VITISV_015691 [Vitis vinifera] 63 2e-08 KNA24992.1 hypothetical protein SOVF_010610 [Spinacia oleracea] 63 2e-08 GAV69070.1 Dimer_Tnp_hAT domain-containing protein/DUF4413 domai... 62 2e-08 CAN68697.1 hypothetical protein VITISV_042570, partial [Vitis vi... 63 2e-08 CAN80126.1 hypothetical protein VITISV_013417 [Vitis vinifera] 63 2e-08 >XP_015389776.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Citrus sinensis] Length = 254 Score = 69.3 bits (168), Expect = 4e-11 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -2 Query: 516 VSTVASESIFNMGGRVVSPHCNKLHPQTLEALMCSQSWLRA 394 VSTVASES F+ GGR +SPHC++LHP+TLEALMC+Q+WL A Sbjct: 144 VSTVASESAFSTGGRFISPHCSRLHPKTLEALMCAQNWLFA 184 >XP_019056059.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Nelumbo nucifera] Length = 156 Score = 65.9 bits (159), Expect = 2e-10 Identities = 28/47 (59%), Positives = 40/47 (85%) Frame = -2 Query: 516 VSTVASESIFNMGGRVVSPHCNKLHPQTLEALMCSQSWLRA*AKGIN 376 +ST+ASES+FN GGR+VSPH ++LH +TLEALMC+Q+WL +G++ Sbjct: 72 ISTMASESVFNTGGRLVSPHRSRLHVETLEALMCAQNWLLKQVQGVH 118 >KZV55410.1 hypothetical protein F511_06460, partial [Dorcoceras hygrometricum] Length = 241 Score = 65.9 bits (159), Expect = 7e-10 Identities = 30/48 (62%), Positives = 39/48 (81%) Frame = -2 Query: 516 VSTVASESIFNMGGRVVSPHCNKLHPQTLEALMCSQSWLRA*AKGINY 373 VSTVASES F+ GGRV+S H N+LHP+T+EALMC++ WL + +GI Y Sbjct: 148 VSTVASESTFSTGGRVLSAHRNRLHPKTVEALMCARDWLWSETQGIRY 195 >KZV42483.1 hypothetical protein F511_36149, partial [Dorcoceras hygrometricum] Length = 235 Score = 65.5 bits (158), Expect = 8e-10 Identities = 30/48 (62%), Positives = 39/48 (81%) Frame = -2 Query: 516 VSTVASESIFNMGGRVVSPHCNKLHPQTLEALMCSQSWLRA*AKGINY 373 VSTVASES F+ GGRV+S H N+LHP+T+EALMC++ WL + +GI Y Sbjct: 142 VSTVASESTFSTGGRVLSAHRNRLHPKTVEALMCARDWLWSEMQGIRY 189 >XP_019074902.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Vitis vinifera] Length = 149 Score = 63.2 bits (152), Expect = 2e-09 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -2 Query: 516 VSTVASESIFNMGGRVVSPHCNKLHPQTLEALMCSQSWL 400 VSTVASES F+ GGR+VS H ++LHP TLEALMC+QSWL Sbjct: 90 VSTVASESAFSTGGRMVSKHRSRLHPNTLEALMCAQSWL 128 >XP_010649234.2 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Vitis vinifera] Length = 149 Score = 63.2 bits (152), Expect = 2e-09 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -2 Query: 516 VSTVASESIFNMGGRVVSPHCNKLHPQTLEALMCSQSWL 400 VSTVASES F+ GGR+VS H ++LHP TLEALMC+QSWL Sbjct: 90 VSTVASESAFSTGGRMVSKHRSRLHPNTLEALMCAQSWL 128 >GAV91543.1 Dimer_Tnp_hAT domain-containing protein/DUF4413 domain-containing protein [Cephalotus follicularis] Length = 276 Score = 64.7 bits (156), Expect = 2e-09 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = -2 Query: 516 VSTVASESIFNMGGRVVSPHCNKLHPQTLEALMCSQSWLRA 394 +STVASES F+MGGR+VSPH ++LHP T+EAL C+QSWL A Sbjct: 161 ISTVASESTFSMGGRLVSPHRSRLHPTTVEALACTQSWLWA 201 >OMO58912.1 putative Zinc finger, BED-type [Corchorus capsularis] Length = 609 Score = 65.1 bits (157), Expect = 3e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -2 Query: 516 VSTVASESIFNMGGRVVSPHCNKLHPQTLEALMCSQSWL 400 VSTVASES F+ GRVVSPH ++LHP TLEALMCSQ+WL Sbjct: 540 VSTVASESAFSTSGRVVSPHRSRLHPNTLEALMCSQNWL 578 >XP_015877255.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 3-like [Ziziphus jujuba] Length = 168 Score = 62.4 bits (150), Expect = 4e-09 Identities = 28/48 (58%), Positives = 36/48 (75%) Frame = -2 Query: 516 VSTVASESIFNMGGRVVSPHCNKLHPQTLEALMCSQSWLRA*AKGINY 373 VST+ASES F+ GGR VSPH ++LHP+T+EA MC+Q WL A +Y Sbjct: 76 VSTIASESTFSTGGRFVSPHRSRLHPKTVEAFMCAQDWLWAEVNASSY 123 >CAN78054.1 hypothetical protein VITISV_017198 [Vitis vinifera] Length = 345 Score = 63.9 bits (154), Expect = 7e-09 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -2 Query: 516 VSTVASESIFNMGGRVVSPHCNKLHPQTLEALMCSQSWL 400 VST+ASES F+ GGRVVS H ++LHP TLEALMC+QSWL Sbjct: 297 VSTIASESAFSTGGRVVSKHRSRLHPDTLEALMCAQSWL 335 >KZV18122.1 hypothetical protein F511_25448 [Dorcoceras hygrometricum] Length = 150 Score = 61.2 bits (147), Expect = 8e-09 Identities = 28/46 (60%), Positives = 38/46 (82%) Frame = -2 Query: 516 VSTVASESIFNMGGRVVSPHCNKLHPQTLEALMCSQSWLRA*AKGI 379 V+TVASES F+ GGRV+S H N+LHP+T+EALMC++ WL + +GI Sbjct: 60 VTTVASESTFSTGGRVLSVHRNRLHPKTVEALMCARDWLWSEMQGI 105 >KZV22693.1 hypothetical protein F511_05325 [Dorcoceras hygrometricum] Length = 667 Score = 63.5 bits (153), Expect = 1e-08 Identities = 28/48 (58%), Positives = 38/48 (79%) Frame = -2 Query: 516 VSTVASESIFNMGGRVVSPHCNKLHPQTLEALMCSQSWLRA*AKGINY 373 VSTVA ES F+ GGR++S H N+LHP+T+EALMC++ WL + +GI Y Sbjct: 574 VSTVACESTFSTGGRILSAHRNRLHPKTVEALMCARDWLWSETQGIRY 621 >BAT75705.1 hypothetical protein VIGAN_01361400 [Vigna angularis var. angularis] Length = 90 Score = 59.3 bits (142), Expect = 1e-08 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -2 Query: 516 VSTVASESIFNMGGRVVSPHCNKLHPQTLEALMCSQSWL 400 +STVASES F+ GGR ++PH ++LHP TLEALMC Q WL Sbjct: 11 ISTVASESPFSTGGRFLTPHRSRLHPDTLEALMCVQDWL 49 >XP_010655772.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Vitis vinifera] Length = 227 Score = 62.0 bits (149), Expect = 1e-08 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 516 VSTVASESIFNMGGRVVSPHCNKLHPQTLEALMCSQSWL 400 VS VASES F+ GGRVVS H ++LHP TLEALMC+QSWL Sbjct: 160 VSIVASESAFSTGGRVVSKHRSRLHPDTLEALMCAQSWL 198 >XP_016514801.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like, partial [Nicotiana tabacum] Length = 130 Score = 60.1 bits (144), Expect = 2e-08 Identities = 25/39 (64%), Positives = 34/39 (87%) Frame = -2 Query: 516 VSTVASESIFNMGGRVVSPHCNKLHPQTLEALMCSQSWL 400 +STVASES F+ GR++SPH ++LHP TLEALMC+++WL Sbjct: 61 ISTVASESAFSTSGRLISPHRSRLHPTTLEALMCARTWL 99 >CAN83599.1 hypothetical protein VITISV_015691 [Vitis vinifera] Length = 570 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -2 Query: 516 VSTVASESIFNMGGRVVSPHCNKLHPQTLEALMCSQSWL 400 VSTVASES F+ GG+VVS H ++LHP TLEALMC+QSWL Sbjct: 477 VSTVASESAFSTGGKVVSKHRSRLHPDTLEALMCAQSWL 515 >KNA24992.1 hypothetical protein SOVF_010610 [Spinacia oleracea] Length = 645 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = -2 Query: 516 VSTVASESIFNMGGRVVSPHCNKLHPQTLEALMCSQSWLRA*AKGI 379 VSTV SES F+ GRV+ PH ++LHP T+EALMCSQ+W+ A KG+ Sbjct: 565 VSTVPSESAFSTSGRVIDPHRSRLHPDTVEALMCSQNWIWAEIKGV 610 >GAV69070.1 Dimer_Tnp_hAT domain-containing protein/DUF4413 domain-containing protein [Cephalotus follicularis] Length = 276 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -2 Query: 516 VSTVASESIFNMGGRVVSPHCNKLHPQTLEALMCSQSWLRA 394 + TVASES F+MGGR+VSPH ++LHP T+EAL C+QSWL A Sbjct: 161 IFTVASESTFSMGGRLVSPHHSRLHPTTVEALACTQSWLWA 201 >CAN68697.1 hypothetical protein VITISV_042570, partial [Vitis vinifera] Length = 1068 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -2 Query: 516 VSTVASESIFNMGGRVVSPHCNKLHPQTLEALMCSQSWL 400 VSTVASES F+ GGR+VS H ++LHP TLEALMC+QSWL Sbjct: 654 VSTVASESAFSTGGRMVSKHRSRLHPNTLEALMCAQSWL 692 >CAN80126.1 hypothetical protein VITISV_013417 [Vitis vinifera] Length = 1266 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -2 Query: 516 VSTVASESIFNMGGRVVSPHCNKLHPQTLEALMCSQSWL 400 VSTVASES F+ GGR+VS H ++LHP TLEALMC+QSWL Sbjct: 682 VSTVASESAFSTGGRMVSKHRSRLHPNTLEALMCAQSWL 720