BLASTX nr result
ID: Phellodendron21_contig00032305
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00032305 (314 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015382513.1 PREDICTED: uncharacterized protein LOC102614489 i... 73 8e-13 KDO75855.1 hypothetical protein CISIN_1g038419mg [Citrus sinensis] 73 8e-13 XP_006449289.1 hypothetical protein CICLE_v10014177mg [Citrus cl... 71 3e-12 ONI10333.1 hypothetical protein PRUPE_4G041200 [Prunus persica] 64 1e-09 XP_007213034.1 hypothetical protein PRUPE_ppa023167mg [Prunus pe... 64 1e-09 JAU41851.1 hypothetical protein LC_TR4523_c0_g1_i1_g.16305, part... 63 3e-09 XP_008224997.1 PREDICTED: uncharacterized protein LOC103324676 [... 62 7e-09 XP_006467843.1 PREDICTED: uncharacterized protein LOC102614489 i... 62 7e-09 XP_006348387.1 PREDICTED: uncharacterized protein LOC102605866 [... 61 9e-09 XP_012091555.1 PREDICTED: uncharacterized protein LOC105649502 i... 60 2e-08 XP_012091554.1 PREDICTED: uncharacterized protein LOC105649502 i... 60 2e-08 XP_016505146.1 PREDICTED: uncharacterized protein LOC107823064 [... 60 2e-08 XP_009592525.1 PREDICTED: uncharacterized protein LOC104089362 i... 60 2e-08 XP_009592524.1 PREDICTED: uncharacterized protein LOC104089362 i... 60 2e-08 XP_016477578.1 PREDICTED: uncharacterized protein LOC107799028 i... 60 2e-08 XP_009782944.1 PREDICTED: uncharacterized protein LOC104231622 [... 60 2e-08 XP_010533898.1 PREDICTED: uncharacterized protein LOC104809566 [... 59 4e-08 XP_016581249.1 PREDICTED: uncharacterized protein LOC107878683 [... 59 4e-08 XP_002317227.2 hypothetical protein POPTR_0011s04670g [Populus t... 59 6e-08 KDO74141.1 hypothetical protein CISIN_1g001001mg [Citrus sinensis] 59 8e-08 >XP_015382513.1 PREDICTED: uncharacterized protein LOC102614489 isoform X2 [Citrus sinensis] Length = 940 Score = 72.8 bits (177), Expect = 8e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 205 MDSAARLDYALFQLTPTRTRFDLVLFYGRNSEKLAS 312 MDSA+RLDYALFQLTPTRTRFDLVLFYGRNSEKLAS Sbjct: 1 MDSASRLDYALFQLTPTRTRFDLVLFYGRNSEKLAS 36 >KDO75855.1 hypothetical protein CISIN_1g038419mg [Citrus sinensis] Length = 940 Score = 72.8 bits (177), Expect = 8e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 205 MDSAARLDYALFQLTPTRTRFDLVLFYGRNSEKLAS 312 MDSA+RLDYALFQLTPTRTRFDLVLFYGRNSEKLAS Sbjct: 1 MDSASRLDYALFQLTPTRTRFDLVLFYGRNSEKLAS 36 >XP_006449289.1 hypothetical protein CICLE_v10014177mg [Citrus clementina] ESR62529.1 hypothetical protein CICLE_v10014177mg [Citrus clementina] Length = 940 Score = 71.2 bits (173), Expect = 3e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 205 MDSAARLDYALFQLTPTRTRFDLVLFYGRNSEKLAS 312 MDS +RLDYALFQLTPTRTRFDLVLFYGRNSEKLAS Sbjct: 1 MDSVSRLDYALFQLTPTRTRFDLVLFYGRNSEKLAS 36 >ONI10333.1 hypothetical protein PRUPE_4G041200 [Prunus persica] Length = 839 Score = 63.5 bits (153), Expect = 1e-09 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = +1 Query: 205 MDSAARLDYALFQLTPTRTRFDLVLFYGRNSEKLAS 312 MDS ARLDYALFQLTPTRTR DLV+FYG SEKLAS Sbjct: 1 MDSGARLDYALFQLTPTRTRCDLVIFYGGKSEKLAS 36 >XP_007213034.1 hypothetical protein PRUPE_ppa023167mg [Prunus persica] Length = 870 Score = 63.5 bits (153), Expect = 1e-09 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = +1 Query: 205 MDSAARLDYALFQLTPTRTRFDLVLFYGRNSEKLAS 312 MDS ARLDYALFQLTPTRTR DLV+FYG SEKLAS Sbjct: 1 MDSGARLDYALFQLTPTRTRCDLVIFYGGKSEKLAS 36 >JAU41851.1 hypothetical protein LC_TR4523_c0_g1_i1_g.16305, partial [Noccaea caerulescens] Length = 852 Score = 62.8 bits (151), Expect = 3e-09 Identities = 40/67 (59%), Positives = 44/67 (65%) Frame = +1 Query: 112 FLDYNSSKHQLSLK*IKLISCNNISVTSSVAMDSAARLDYALFQLTPTRTRFDLVLFYGR 291 FL +SS+ + K LIS + SS AMDS A LD ALFQLTPTRTRFDLVLF G Sbjct: 16 FLSSSSSERRRRRK-TSLISLSLSHSFSSEAMDSRAILDSALFQLTPTRTRFDLVLFCGS 74 Query: 292 NSEKLAS 312 EKLAS Sbjct: 75 KKEKLAS 81 >XP_008224997.1 PREDICTED: uncharacterized protein LOC103324676 [Prunus mume] Length = 838 Score = 61.6 bits (148), Expect = 7e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 205 MDSAARLDYALFQLTPTRTRFDLVLFYGRNSEKLAS 312 MDS ARL+YALFQLTPTRTR DLV+FYG SEKLAS Sbjct: 1 MDSGARLNYALFQLTPTRTRCDLVIFYGGKSEKLAS 36 >XP_006467843.1 PREDICTED: uncharacterized protein LOC102614489 isoform X1 [Citrus sinensis] Length = 944 Score = 61.6 bits (148), Expect = 7e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 226 DYALFQLTPTRTRFDLVLFYGRNSEKLAS 312 DYALFQLTPTRTRFDLVLFYGRNSEKLAS Sbjct: 12 DYALFQLTPTRTRFDLVLFYGRNSEKLAS 40 >XP_006348387.1 PREDICTED: uncharacterized protein LOC102605866 [Solanum tuberosum] Length = 1110 Score = 61.2 bits (147), Expect = 9e-09 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = +1 Query: 205 MDSAARLDYALFQLTPTRTRFDLVLFYGRNSEKLAS 312 MDS RLDYALFQLTPTRTR DLV+F G NSEKLAS Sbjct: 1 MDSRTRLDYALFQLTPTRTRCDLVIFAGENSEKLAS 36 >XP_012091555.1 PREDICTED: uncharacterized protein LOC105649502 isoform X2 [Jatropha curcas] KDP20927.1 hypothetical protein JCGZ_21398 [Jatropha curcas] Length = 909 Score = 60.5 bits (145), Expect = 2e-08 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 205 MDSAARLDYALFQLTPTRTRFDLVLFYGRNSEKLAS 312 M S+A LDYALFQLTPTRTRFDLVLFYG +EKLAS Sbjct: 1 MASSAILDYALFQLTPTRTRFDLVLFYGGKTEKLAS 36 >XP_012091554.1 PREDICTED: uncharacterized protein LOC105649502 isoform X1 [Jatropha curcas] Length = 913 Score = 60.5 bits (145), Expect = 2e-08 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 205 MDSAARLDYALFQLTPTRTRFDLVLFYGRNSEKLAS 312 M S+A LDYALFQLTPTRTRFDLVLFYG +EKLAS Sbjct: 1 MASSAILDYALFQLTPTRTRFDLVLFYGGKTEKLAS 36 >XP_016505146.1 PREDICTED: uncharacterized protein LOC107823064 [Nicotiana tabacum] Length = 1168 Score = 60.1 bits (144), Expect = 2e-08 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +1 Query: 205 MDSAARLDYALFQLTPTRTRFDLVLFYGRNSEKLAS 312 MDS RLDYALFQLTPTRTR DLV++ G NSEKLAS Sbjct: 1 MDSRTRLDYALFQLTPTRTRCDLVIYAGNNSEKLAS 36 >XP_009592525.1 PREDICTED: uncharacterized protein LOC104089362 isoform X2 [Nicotiana tomentosiformis] Length = 1172 Score = 60.1 bits (144), Expect = 2e-08 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +1 Query: 205 MDSAARLDYALFQLTPTRTRFDLVLFYGRNSEKLAS 312 MDS RLDYALFQLTPTRTR DLV++ G NSEKLAS Sbjct: 1 MDSRTRLDYALFQLTPTRTRCDLVIYAGNNSEKLAS 36 >XP_009592524.1 PREDICTED: uncharacterized protein LOC104089362 isoform X1 [Nicotiana tomentosiformis] Length = 1181 Score = 60.1 bits (144), Expect = 2e-08 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +1 Query: 205 MDSAARLDYALFQLTPTRTRFDLVLFYGRNSEKLAS 312 MDS RLDYALFQLTPTRTR DLV++ G NSEKLAS Sbjct: 1 MDSRTRLDYALFQLTPTRTRCDLVIYAGNNSEKLAS 36 >XP_016477578.1 PREDICTED: uncharacterized protein LOC107799028 isoform X2 [Nicotiana tabacum] Length = 1184 Score = 60.1 bits (144), Expect = 2e-08 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +1 Query: 205 MDSAARLDYALFQLTPTRTRFDLVLFYGRNSEKLAS 312 MDS RLDYALFQLTPTRTR DLV++ G NSEKLAS Sbjct: 1 MDSRTRLDYALFQLTPTRTRCDLVIYAGNNSEKLAS 36 >XP_009782944.1 PREDICTED: uncharacterized protein LOC104231622 [Nicotiana sylvestris] XP_016477577.1 PREDICTED: uncharacterized protein LOC107799028 isoform X1 [Nicotiana tabacum] Length = 1184 Score = 60.1 bits (144), Expect = 2e-08 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +1 Query: 205 MDSAARLDYALFQLTPTRTRFDLVLFYGRNSEKLAS 312 MDS RLDYALFQLTPTRTR DLV++ G NSEKLAS Sbjct: 1 MDSRTRLDYALFQLTPTRTRCDLVIYAGNNSEKLAS 36 >XP_010533898.1 PREDICTED: uncharacterized protein LOC104809566 [Tarenaya hassleriana] Length = 887 Score = 59.3 bits (142), Expect = 4e-08 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = +1 Query: 178 NISVTSSVAMDSAARLDYALFQLTPTRTRFDLVLFYGRNSEKLAS 312 ++S++ AM+SAA LD ALFQLTPTRTRFDLVLF G EKLAS Sbjct: 32 SLSLSLLEAMESAALLDSALFQLTPTRTRFDLVLFCGSKKEKLAS 76 >XP_016581249.1 PREDICTED: uncharacterized protein LOC107878683 [Capsicum annuum] Length = 1122 Score = 59.3 bits (142), Expect = 4e-08 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +1 Query: 205 MDSAARLDYALFQLTPTRTRFDLVLFYGRNSEKLAS 312 MDS RLDYALFQLTPTRTR DLV+F G +SEKLAS Sbjct: 1 MDSRTRLDYALFQLTPTRTRCDLVIFAGNHSEKLAS 36 >XP_002317227.2 hypothetical protein POPTR_0011s04670g [Populus trichocarpa] EEE97839.2 hypothetical protein POPTR_0011s04670g [Populus trichocarpa] Length = 927 Score = 58.9 bits (141), Expect = 6e-08 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +1 Query: 199 VAMDSAARLDYALFQLTPTRTRFDLVLFYGRNSEKLAS 312 V M+S+ LDYALFQLTPTRTR DLVLFYG +EKLAS Sbjct: 2 VTMNSSTLLDYALFQLTPTRTRCDLVLFYGGKNEKLAS 39 >KDO74141.1 hypothetical protein CISIN_1g001001mg [Citrus sinensis] Length = 841 Score = 58.5 bits (140), Expect = 8e-08 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +1 Query: 205 MDSAARLDYALFQLTPTRTRFDLVLFYGRNSEKLAS 312 MDS RLDYALFQLTPTRTR DLV+F G +SEKLAS Sbjct: 1 MDSRTRLDYALFQLTPTRTRCDLVIFAGDSSEKLAS 36