BLASTX nr result
ID: Phellodendron21_contig00032212
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00032212 (263 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU48346.1 hypothetical protein TSUD_267710 [Trifolium subterran... 63 1e-09 XP_012572879.1 PREDICTED: splicing factor U2af large subunit A-l... 63 1e-09 XP_019465470.1 PREDICTED: splicing factor U2af large subunit A-l... 54 2e-06 KVI00172.1 Nucleotide-binding, alpha-beta plait [Cynara carduncu... 52 9e-06 >GAU48346.1 hypothetical protein TSUD_267710 [Trifolium subterraneum] Length = 585 Score = 62.8 bits (151), Expect = 1e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 108 MLGYLPHCADNGREPTSVAFMYKKDSMHRF 197 MLGYLPHCADNGREPTSVAFM K++SMHRF Sbjct: 206 MLGYLPHCADNGREPTSVAFMSKEESMHRF 235 >XP_012572879.1 PREDICTED: splicing factor U2af large subunit A-like isoform X5 [Cicer arietinum] Length = 636 Score = 62.8 bits (151), Expect = 1e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 105 AMLGYLPHCADNGREPTSVAFMYKKDSMHRF 197 AMLGYLPHCADNGREPTSVAFM K++S+HRF Sbjct: 209 AMLGYLPHCADNGREPTSVAFMSKEESVHRF 239 >XP_019465470.1 PREDICTED: splicing factor U2af large subunit A-like isoform X4 [Lupinus angustifolius] XP_019465471.1 PREDICTED: splicing factor U2af large subunit A-like isoform X4 [Lupinus angustifolius] Length = 450 Score = 53.5 bits (127), Expect = 2e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +3 Query: 108 MLGYLPHCADNGREPTSVAFMYKKDSMHRF 197 M+GYLPHCADNG EPTSVAFM +DS+H F Sbjct: 1 MVGYLPHCADNGCEPTSVAFMSMEDSLHWF 30 >KVI00172.1 Nucleotide-binding, alpha-beta plait [Cynara cardunculus var. scolymus] Length = 634 Score = 52.0 bits (123), Expect = 9e-06 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = +3 Query: 120 LPHCADNGREPTSVAFMYKKDSMHRFDGYC 209 LPHCA+NG EPTSVAFMYK++S+ +DG C Sbjct: 211 LPHCAENGCEPTSVAFMYKEESLQWYDGSC 240