BLASTX nr result
ID: Phellodendron21_contig00032186
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00032186 (307 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006369708.1 hypothetical protein POPTR_0001s29500g, partial [... 59 2e-09 ACH42358.1 ribosomal protein L2, partial (mitochondrion) [Eschsc... 55 3e-07 >XP_006369708.1 hypothetical protein POPTR_0001s29500g, partial [Populus trichocarpa] ERP66277.1 hypothetical protein POPTR_0001s29500g, partial [Populus trichocarpa] Length = 72 Score = 58.5 bits (140), Expect = 2e-09 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -3 Query: 305 FDQRLIATCPECPSILRPYSHSGERPSGRG 216 FD RLIAT PECPSILRPYSHS ERPSGRG Sbjct: 23 FDLRLIATRPECPSILRPYSHSEERPSGRG 52 >ACH42358.1 ribosomal protein L2, partial (mitochondrion) [Eschscholzia californica] Length = 164 Score = 55.1 bits (131), Expect = 3e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -1 Query: 307 PSTSDLLRPAQNAHPY*DLIHTAEKGRVEGG 215 PSTS LRPAQNAH Y DL+HTA KGRVEGG Sbjct: 1 PSTSGFLRPAQNAHTYQDLVHTANKGRVEGG 31