BLASTX nr result
ID: Phellodendron21_contig00032151
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00032151 (410 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015889422.1 PREDICTED: probable plastid-lipid-associated prot... 67 7e-11 ONK56315.1 uncharacterized protein A4U43_C10F6730 [Asparagus off... 65 5e-10 XP_006838194.1 PREDICTED: probable plastid-lipid-associated prot... 65 6e-10 KNA16119.1 hypothetical protein SOVF_092090 [Spinacia oleracea] 64 8e-10 XP_010692132.1 PREDICTED: probable plastid-lipid-associated prot... 64 8e-10 XP_018854083.1 PREDICTED: probable plastid-lipid-associated prot... 63 1e-09 XP_018854066.1 PREDICTED: probable plastid-lipid-associated prot... 63 2e-09 XP_010053949.1 PREDICTED: probable plastid-lipid-associated prot... 62 2e-09 KHN42525.1 Putative plastid-lipid-associated protein 11, chlorop... 61 2e-09 KMZ73787.1 Plastid-lipid associated protein pap [Zostera marina] 63 2e-09 XP_018854061.1 PREDICTED: probable plastid-lipid-associated prot... 63 3e-09 XP_010053947.1 PREDICTED: probable plastid-lipid-associated prot... 62 3e-09 XP_019188928.1 PREDICTED: probable plastid-lipid-associated prot... 62 5e-09 KVH88245.1 Plastid lipid-associated protein/fibrillin conserved ... 62 5e-09 OAY62472.1 hypothetical protein MANES_01G270400 [Manihot esculen... 61 7e-09 XP_010258895.1 PREDICTED: probable plastid-lipid-associated prot... 62 8e-09 XP_020093362.1 probable plastid-lipid-associated protein 11 [Ana... 62 8e-09 XP_010919589.1 PREDICTED: probable plastid-lipid-associated prot... 62 8e-09 XP_008802828.1 PREDICTED: probable plastid-lipid-associated prot... 62 8e-09 OAY65926.1 putative plastid-lipid-associated protein 11 [Ananas ... 62 8e-09 >XP_015889422.1 PREDICTED: probable plastid-lipid-associated protein 11 [Ziziphus jujuba] Length = 225 Score = 67.0 bits (162), Expect = 7e-11 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +1 Query: 22 FESVYLDDNIRIAKDIRGDYLVVNRAPYNWKE*VFRLSFW 141 FESVYLDD+IR+AKDIRGDYLVV+ APYNWK+ + RL W Sbjct: 186 FESVYLDDDIRVAKDIRGDYLVVDHAPYNWKD-ILRLHVW 224 >ONK56315.1 uncharacterized protein A4U43_C10F6730 [Asparagus officinalis] Length = 220 Score = 64.7 bits (156), Expect = 5e-10 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = +1 Query: 22 FESVYLDDNIRIAKDIRGDYLVVNRAPYNWKE 117 FESVYLDD+IR+AKDIRGDYLVV+RAPY+WKE Sbjct: 189 FESVYLDDDIRVAKDIRGDYLVVDRAPYSWKE 220 >XP_006838194.1 PREDICTED: probable plastid-lipid-associated protein 11 [Amborella trichopoda] ERN00763.1 hypothetical protein AMTR_s00106p00140380 [Amborella trichopoda] Length = 226 Score = 64.7 bits (156), Expect = 6e-10 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +1 Query: 22 FESVYLDDNIRIAKDIRGDYLVVNRAPYNWKE 117 FES+YLDD+IR+ KDIRGDYLVV+RAPYNWKE Sbjct: 195 FESIYLDDDIRVVKDIRGDYLVVDRAPYNWKE 226 >KNA16119.1 hypothetical protein SOVF_092090 [Spinacia oleracea] Length = 225 Score = 64.3 bits (155), Expect = 8e-10 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 22 FESVYLDDNIRIAKDIRGDYLVVNRAPYNWKE 117 FESVYLDD+IR+AKDIRGDYLVV+RAPY WKE Sbjct: 194 FESVYLDDDIRVAKDIRGDYLVVDRAPYEWKE 225 >XP_010692132.1 PREDICTED: probable plastid-lipid-associated protein 11 isoform X1 [Beta vulgaris subsp. vulgaris] KMT00004.1 hypothetical protein BVRB_1g018400 [Beta vulgaris subsp. vulgaris] Length = 226 Score = 64.3 bits (155), Expect = 8e-10 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 22 FESVYLDDNIRIAKDIRGDYLVVNRAPYNWKE 117 FESVYLDD+IR+AKDIRGDYLVV+RAPY WKE Sbjct: 195 FESVYLDDDIRVAKDIRGDYLVVDRAPYEWKE 226 >XP_018854083.1 PREDICTED: probable plastid-lipid-associated protein 11 isoform X3 [Juglans regia] Length = 194 Score = 63.2 bits (152), Expect = 1e-09 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +1 Query: 22 FESVYLDDNIRIAKDIRGDYLVVNRAPYNWKE 117 FESVYLDD+IR+AKDIRGDYL+V+ APYNWKE Sbjct: 163 FESVYLDDDIRVAKDIRGDYLIVDCAPYNWKE 194 >XP_018854066.1 PREDICTED: probable plastid-lipid-associated protein 11 isoform X2 [Juglans regia] XP_018854077.1 PREDICTED: probable plastid-lipid-associated protein 11 isoform X2 [Juglans regia] Length = 216 Score = 63.2 bits (152), Expect = 2e-09 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +1 Query: 22 FESVYLDDNIRIAKDIRGDYLVVNRAPYNWKE 117 FESVYLDD+IR+AKDIRGDYL+V+ APYNWKE Sbjct: 185 FESVYLDDDIRVAKDIRGDYLIVDCAPYNWKE 216 >XP_010053949.1 PREDICTED: probable plastid-lipid-associated protein 11 isoform X2 [Eucalyptus grandis] Length = 185 Score = 62.4 bits (150), Expect = 2e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 22 FESVYLDDNIRIAKDIRGDYLVVNRAPYNWKE 117 FE+VYLDD IR+AKDIRGDYL+V RAPY+WKE Sbjct: 154 FENVYLDDEIRVAKDIRGDYLIVERAPYDWKE 185 >KHN42525.1 Putative plastid-lipid-associated protein 11, chloroplastic, partial [Glycine soja] Length = 116 Score = 60.8 bits (146), Expect = 2e-09 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +1 Query: 22 FESVYLDDNIRIAKDIRGDYLVVNRAPYNWKE 117 F++VYLDD++R+ KDIRGDYLVVNRA YNWKE Sbjct: 85 FDTVYLDDDLRVVKDIRGDYLVVNRASYNWKE 116 >KMZ73787.1 Plastid-lipid associated protein pap [Zostera marina] Length = 212 Score = 62.8 bits (151), Expect = 2e-09 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +1 Query: 22 FESVYLDDNIRIAKDIRGDYLVVNRAPYNWKE 117 FESVY+DD+IR+AKDIRGDYLVV+RAPY WKE Sbjct: 181 FESVYIDDDIRVAKDIRGDYLVVDRAPYAWKE 212 >XP_018854061.1 PREDICTED: probable plastid-lipid-associated protein 11 isoform X1 [Juglans regia] XP_018854073.1 PREDICTED: probable plastid-lipid-associated protein 11 isoform X1 [Juglans regia] Length = 216 Score = 62.8 bits (151), Expect = 3e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +1 Query: 22 FESVYLDDNIRIAKDIRGDYLVVNRAPYNWKE 117 FESVYLDD IR+ KDIRGDYLVV+RAPY+WKE Sbjct: 185 FESVYLDDEIRVVKDIRGDYLVVDRAPYSWKE 216 >XP_010053947.1 PREDICTED: probable plastid-lipid-associated protein 11 isoform X1 [Eucalyptus grandis] Length = 207 Score = 62.4 bits (150), Expect = 3e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 22 FESVYLDDNIRIAKDIRGDYLVVNRAPYNWKE 117 FE+VYLDD IR+AKDIRGDYL+V RAPY+WKE Sbjct: 176 FENVYLDDEIRVAKDIRGDYLIVERAPYDWKE 207 >XP_019188928.1 PREDICTED: probable plastid-lipid-associated protein 11 isoform X1 [Ipomoea nil] XP_019188929.1 PREDICTED: probable plastid-lipid-associated protein 11 isoform X1 [Ipomoea nil] XP_019188931.1 PREDICTED: probable plastid-lipid-associated protein 11 isoform X1 [Ipomoea nil] Length = 212 Score = 62.0 bits (149), Expect = 5e-09 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 22 FESVYLDDNIRIAKDIRGDYLVVNRAPYNWKE 117 F++VYLDD IR+ KDIRGDYLVV RAPYNWKE Sbjct: 181 FDTVYLDDEIRVVKDIRGDYLVVERAPYNWKE 212 >KVH88245.1 Plastid lipid-associated protein/fibrillin conserved domain-containing protein [Cynara cardunculus var. scolymus] Length = 214 Score = 62.0 bits (149), Expect = 5e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +1 Query: 22 FESVYLDDNIRIAKDIRGDYLVVNRAPYNWKE 117 F+SVYLDDNIRIAKDIRGDYL+V+RA Y WKE Sbjct: 183 FDSVYLDDNIRIAKDIRGDYLIVDRASYQWKE 214 >OAY62472.1 hypothetical protein MANES_01G270400 [Manihot esculenta] OAY62474.1 hypothetical protein MANES_01G270400 [Manihot esculenta] Length = 190 Score = 61.2 bits (147), Expect = 7e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 22 FESVYLDDNIRIAKDIRGDYLVVNRAPYNWKE 117 FESVY+DD+IR+ KDIRGDYLVV+RAPY WKE Sbjct: 159 FESVYIDDDIRVVKDIRGDYLVVDRAPYAWKE 190 >XP_010258895.1 PREDICTED: probable plastid-lipid-associated protein 11 [Nelumbo nucifera] XP_019053522.1 PREDICTED: probable plastid-lipid-associated protein 11 [Nelumbo nucifera] Length = 225 Score = 61.6 bits (148), Expect = 8e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 22 FESVYLDDNIRIAKDIRGDYLVVNRAPYNWKE 117 FESVYLDD IR+ +DIRGDYLVV+RAPY+WKE Sbjct: 194 FESVYLDDEIRVVRDIRGDYLVVDRAPYHWKE 225 >XP_020093362.1 probable plastid-lipid-associated protein 11 [Ananas comosus] Length = 229 Score = 61.6 bits (148), Expect = 8e-09 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +1 Query: 22 FESVYLDDNIRIAKDIRGDYLVVNRAPYNWKE 117 FESVYLD++IR+ KDIRGDYLVV+RAPY+WKE Sbjct: 198 FESVYLDEDIRVVKDIRGDYLVVDRAPYSWKE 229 >XP_010919589.1 PREDICTED: probable plastid-lipid-associated protein 11 isoform X1 [Elaeis guineensis] Length = 229 Score = 61.6 bits (148), Expect = 8e-09 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +1 Query: 22 FESVYLDDNIRIAKDIRGDYLVVNRAPYNWKE 117 FESVYLD++IR+AKDIRGDYLVV+RAPY WKE Sbjct: 198 FESVYLDEDIRVAKDIRGDYLVVDRAPYFWKE 229 >XP_008802828.1 PREDICTED: probable plastid-lipid-associated protein 11 [Phoenix dactylifera] Length = 233 Score = 61.6 bits (148), Expect = 8e-09 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +1 Query: 22 FESVYLDDNIRIAKDIRGDYLVVNRAPYNWKE 117 FESVYLD++IR+AKDIRGDYLVV+RAPY WKE Sbjct: 202 FESVYLDEDIRVAKDIRGDYLVVDRAPYCWKE 233 >OAY65926.1 putative plastid-lipid-associated protein 11 [Ananas comosus] Length = 234 Score = 61.6 bits (148), Expect = 8e-09 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +1 Query: 22 FESVYLDDNIRIAKDIRGDYLVVNRAPYNWKE 117 FESVYLD++IR+ KDIRGDYLVV+RAPY+WKE Sbjct: 203 FESVYLDEDIRVVKDIRGDYLVVDRAPYSWKE 234