BLASTX nr result
ID: Phellodendron21_contig00032131
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00032131 (283 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO63142.1 hypothetical protein CISIN_1g0202051mg, partial [Citr... 66 5e-11 XP_006430665.1 hypothetical protein CICLE_v10012172mg [Citrus cl... 66 1e-10 >KDO63142.1 hypothetical protein CISIN_1g0202051mg, partial [Citrus sinensis] Length = 226 Score = 65.9 bits (159), Expect = 5e-11 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -3 Query: 281 SRKAKKKLPSEHNLLQNGHVGFQRGGADRDTEQ*KKEYAPV 159 SRKAKKKLPSEHNLLQNG++G Q GG DR TE+ KKE APV Sbjct: 186 SRKAKKKLPSEHNLLQNGNIGGQGGGEDRGTEEEKKESAPV 226 >XP_006430665.1 hypothetical protein CICLE_v10012172mg [Citrus clementina] XP_006482162.1 PREDICTED: ATP-dependent Clp protease proteolytic subunit 3, chloroplastic [Citrus sinensis] ESR43905.1 hypothetical protein CICLE_v10012172mg [Citrus clementina] Length = 329 Score = 65.9 bits (159), Expect = 1e-10 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -3 Query: 281 SRKAKKKLPSEHNLLQNGHVGFQRGGADRDTEQ*KKEYAPV 159 SRKAKKKLPSEHNLLQNG++G Q GG DR TE+ KKE APV Sbjct: 289 SRKAKKKLPSEHNLLQNGNIGGQGGGEDRGTEEEKKESAPV 329