BLASTX nr result
ID: Phellodendron21_contig00031981
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00031981 (817 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO68775.1 hypothetical protein CISIN_1g035032mg [Citrus sinensis] 59 7e-08 XP_006444104.1 hypothetical protein CICLE_v10023167mg [Citrus cl... 59 7e-08 OAY61684.1 hypothetical protein MANES_01G208800 [Manihot esculenta] 56 7e-07 XP_015575647.1 PREDICTED: outer envelope membrane protein 7 [Ric... 55 2e-06 >KDO68775.1 hypothetical protein CISIN_1g035032mg [Citrus sinensis] Length = 75 Score = 58.5 bits (140), Expect = 7e-08 Identities = 34/65 (52%), Positives = 40/65 (61%) Frame = +1 Query: 16 MKKALTVLGALAFG*LAIEMAFKPFIDKARAAMXXXXXXXXXXXXXXXQNKESPSVDTAE 195 MKKALTV+GALAFG LAIE+A KPF+DK RAAM N+ S D + Sbjct: 1 MKKALTVVGALAFGWLAIELALKPFLDKVRAAMDKSDPARDPDDAVEGSNEASSESD--D 58 Query: 196 ASDDK 210 A+DDK Sbjct: 59 AADDK 63 >XP_006444104.1 hypothetical protein CICLE_v10023167mg [Citrus clementina] ESR57344.1 hypothetical protein CICLE_v10023167mg [Citrus clementina] Length = 75 Score = 58.5 bits (140), Expect = 7e-08 Identities = 34/65 (52%), Positives = 40/65 (61%) Frame = +1 Query: 16 MKKALTVLGALAFG*LAIEMAFKPFIDKARAAMXXXXXXXXXXXXXXXQNKESPSVDTAE 195 MKKALTV+GALAFG LAIE+A KPF+DK RAAM N+ S D + Sbjct: 1 MKKALTVVGALAFGWLAIELALKPFLDKVRAAMDKSDPARDPDDAVEGSNEASSESD--D 58 Query: 196 ASDDK 210 A+DDK Sbjct: 59 AADDK 63 >OAY61684.1 hypothetical protein MANES_01G208800 [Manihot esculenta] Length = 73 Score = 55.8 bits (133), Expect = 7e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +1 Query: 10 RKMKKALTVLGALAFG*LAIEMAFKPFIDKARAAM 114 + MK+A+ V GALAFG LAIEMAFKPF+DKARAAM Sbjct: 4 KPMKQAMVVFGALAFGWLAIEMAFKPFLDKARAAM 38 >XP_015575647.1 PREDICTED: outer envelope membrane protein 7 [Ricinus communis] EEF41725.1 conserved hypothetical protein [Ricinus communis] Length = 69 Score = 54.7 bits (130), Expect = 2e-06 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = +1 Query: 10 RKMKKALTVLGALAFG*LAIEMAFKPFIDKARAAM 114 + +K+A+ V+GALAFG LAIEMAFKPF+DKARAAM Sbjct: 4 KPVKQAMVVVGALAFGWLAIEMAFKPFLDKARAAM 38