BLASTX nr result
ID: Phellodendron21_contig00031953
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00031953 (393 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO66405.1 hypothetical protein CISIN_1g003865mg [Citrus sinensis] 58 3e-07 XP_011004379.1 PREDICTED: serrate RNA effector molecule-like [Po... 58 3e-07 OAY22190.1 hypothetical protein MANES_S021700 [Manihot esculenta] 58 3e-07 OAY22189.1 hypothetical protein MANES_S021700 [Manihot esculenta] 58 3e-07 XP_012066284.1 PREDICTED: serrate RNA effector molecule [Jatroph... 58 3e-07 OAY37567.1 hypothetical protein MANES_11G111400 [Manihot esculenta] 58 3e-07 XP_002312847.2 hypothetical protein POPTR_0009s16020g [Populus t... 58 3e-07 XP_006470449.1 PREDICTED: serrate RNA effector molecule [Citrus ... 58 3e-07 XP_006446370.1 hypothetical protein CICLE_v10014331mg [Citrus cl... 58 3e-07 KDO66401.1 hypothetical protein CISIN_1g003865mg [Citrus sinensis] 58 3e-07 XP_006446369.1 hypothetical protein CICLE_v10014331mg [Citrus cl... 58 3e-07 GAV89660.1 ARS2 domain-containing protein/DUF3546 domain-contain... 57 5e-07 XP_015576306.1 PREDICTED: serrate RNA effector molecule [Ricinus... 57 7e-07 EEF40752.1 arsenite-resistance protein, putative [Ricinus communis] 57 7e-07 XP_011006396.1 PREDICTED: serrate RNA effector molecule [Populus... 57 9e-07 XP_006384745.1 hypothetical protein POPTR_0004s20730g [Populus t... 57 9e-07 XP_010473101.1 PREDICTED: serrate RNA effector molecule-like [Ca... 54 2e-06 XP_008349834.1 PREDICTED: serrate RNA effector molecule-like [Ma... 53 4e-06 XP_018461565.1 PREDICTED: serrate RNA effector molecule-like [Ra... 54 6e-06 XP_018484894.1 PREDICTED: serrate RNA effector molecule-like [Ra... 54 6e-06 >KDO66405.1 hypothetical protein CISIN_1g003865mg [Citrus sinensis] Length = 541 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/36 (83%), Positives = 32/36 (88%), Gaps = 4/36 (11%) Frame = -1 Query: 393 PILLSPAFR----RIRSYQDLNAPEDEVTVLDYRSL 298 PILLSPAFR RIRSYQDL+APEDEVTV+DYRSL Sbjct: 506 PILLSPAFRQDPRRIRSYQDLDAPEDEVTVMDYRSL 541 >XP_011004379.1 PREDICTED: serrate RNA effector molecule-like [Populus euphratica] Length = 707 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/36 (83%), Positives = 32/36 (88%), Gaps = 4/36 (11%) Frame = -1 Query: 393 PILLSPAFR----RIRSYQDLNAPEDEVTVLDYRSL 298 PILLSPAFR RIRSYQDL+APEDEVTV+DYRSL Sbjct: 672 PILLSPAFRQDPRRIRSYQDLDAPEDEVTVIDYRSL 707 >OAY22190.1 hypothetical protein MANES_S021700 [Manihot esculenta] Length = 734 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/36 (83%), Positives = 32/36 (88%), Gaps = 4/36 (11%) Frame = -1 Query: 393 PILLSPAFR----RIRSYQDLNAPEDEVTVLDYRSL 298 PILLSPAFR RIRSYQDL+APEDEVTV+DYRSL Sbjct: 699 PILLSPAFRQDPRRIRSYQDLDAPEDEVTVIDYRSL 734 >OAY22189.1 hypothetical protein MANES_S021700 [Manihot esculenta] Length = 742 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/36 (83%), Positives = 32/36 (88%), Gaps = 4/36 (11%) Frame = -1 Query: 393 PILLSPAFR----RIRSYQDLNAPEDEVTVLDYRSL 298 PILLSPAFR RIRSYQDL+APEDEVTV+DYRSL Sbjct: 707 PILLSPAFRQDPRRIRSYQDLDAPEDEVTVIDYRSL 742 >XP_012066284.1 PREDICTED: serrate RNA effector molecule [Jatropha curcas] KDP42903.1 hypothetical protein JCGZ_23845 [Jatropha curcas] Length = 742 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/36 (83%), Positives = 32/36 (88%), Gaps = 4/36 (11%) Frame = -1 Query: 393 PILLSPAFR----RIRSYQDLNAPEDEVTVLDYRSL 298 PILLSPAFR RIRSYQDL+APEDEVTV+DYRSL Sbjct: 707 PILLSPAFRQDPRRIRSYQDLDAPEDEVTVIDYRSL 742 >OAY37567.1 hypothetical protein MANES_11G111400 [Manihot esculenta] Length = 744 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/36 (83%), Positives = 32/36 (88%), Gaps = 4/36 (11%) Frame = -1 Query: 393 PILLSPAFR----RIRSYQDLNAPEDEVTVLDYRSL 298 PILLSPAFR RIRSYQDL+APEDEVTV+DYRSL Sbjct: 709 PILLSPAFRQDPRRIRSYQDLDAPEDEVTVIDYRSL 744 >XP_002312847.2 hypothetical protein POPTR_0009s16020g [Populus trichocarpa] EEE86802.2 hypothetical protein POPTR_0009s16020g [Populus trichocarpa] Length = 746 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/36 (83%), Positives = 32/36 (88%), Gaps = 4/36 (11%) Frame = -1 Query: 393 PILLSPAFR----RIRSYQDLNAPEDEVTVLDYRSL 298 PILLSPAFR RIRSYQDL+APEDEVTV+DYRSL Sbjct: 711 PILLSPAFRQDPRRIRSYQDLDAPEDEVTVIDYRSL 746 >XP_006470449.1 PREDICTED: serrate RNA effector molecule [Citrus sinensis] KDO66402.1 hypothetical protein CISIN_1g003865mg [Citrus sinensis] Length = 766 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/36 (83%), Positives = 32/36 (88%), Gaps = 4/36 (11%) Frame = -1 Query: 393 PILLSPAFR----RIRSYQDLNAPEDEVTVLDYRSL 298 PILLSPAFR RIRSYQDL+APEDEVTV+DYRSL Sbjct: 731 PILLSPAFRQDPRRIRSYQDLDAPEDEVTVMDYRSL 766 >XP_006446370.1 hypothetical protein CICLE_v10014331mg [Citrus clementina] ESR59610.1 hypothetical protein CICLE_v10014331mg [Citrus clementina] Length = 766 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/36 (83%), Positives = 32/36 (88%), Gaps = 4/36 (11%) Frame = -1 Query: 393 PILLSPAFR----RIRSYQDLNAPEDEVTVLDYRSL 298 PILLSPAFR RIRSYQDL+APEDEVTV+DYRSL Sbjct: 731 PILLSPAFRQDPRRIRSYQDLDAPEDEVTVMDYRSL 766 >KDO66401.1 hypothetical protein CISIN_1g003865mg [Citrus sinensis] Length = 790 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/36 (83%), Positives = 32/36 (88%), Gaps = 4/36 (11%) Frame = -1 Query: 393 PILLSPAFR----RIRSYQDLNAPEDEVTVLDYRSL 298 PILLSPAFR RIRSYQDL+APEDEVTV+DYRSL Sbjct: 755 PILLSPAFRQDPRRIRSYQDLDAPEDEVTVMDYRSL 790 >XP_006446369.1 hypothetical protein CICLE_v10014331mg [Citrus clementina] ESR59609.1 hypothetical protein CICLE_v10014331mg [Citrus clementina] Length = 790 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/36 (83%), Positives = 32/36 (88%), Gaps = 4/36 (11%) Frame = -1 Query: 393 PILLSPAFR----RIRSYQDLNAPEDEVTVLDYRSL 298 PILLSPAFR RIRSYQDL+APEDEVTV+DYRSL Sbjct: 755 PILLSPAFRQDPRRIRSYQDLDAPEDEVTVMDYRSL 790 >GAV89660.1 ARS2 domain-containing protein/DUF3546 domain-containing protein [Cephalotus follicularis] Length = 752 Score = 57.4 bits (137), Expect = 5e-07 Identities = 29/36 (80%), Positives = 32/36 (88%), Gaps = 4/36 (11%) Frame = -1 Query: 393 PILLSPAFR----RIRSYQDLNAPEDEVTVLDYRSL 298 PILLSPAFR R+RSYQDL+APEDEVTV+DYRSL Sbjct: 717 PILLSPAFRQDPRRLRSYQDLDAPEDEVTVIDYRSL 752 >XP_015576306.1 PREDICTED: serrate RNA effector molecule [Ricinus communis] Length = 752 Score = 57.0 bits (136), Expect = 7e-07 Identities = 29/36 (80%), Positives = 32/36 (88%), Gaps = 4/36 (11%) Frame = -1 Query: 393 PILLSPAFR----RIRSYQDLNAPEDEVTVLDYRSL 298 PILLSPAFR RIRSYQDL+AP+DEVTV+DYRSL Sbjct: 717 PILLSPAFRQDPRRIRSYQDLDAPDDEVTVIDYRSL 752 >EEF40752.1 arsenite-resistance protein, putative [Ricinus communis] Length = 823 Score = 57.0 bits (136), Expect = 7e-07 Identities = 29/36 (80%), Positives = 32/36 (88%), Gaps = 4/36 (11%) Frame = -1 Query: 393 PILLSPAFR----RIRSYQDLNAPEDEVTVLDYRSL 298 PILLSPAFR RIRSYQDL+AP+DEVTV+DYRSL Sbjct: 788 PILLSPAFRQDPRRIRSYQDLDAPDDEVTVIDYRSL 823 >XP_011006396.1 PREDICTED: serrate RNA effector molecule [Populus euphratica] Length = 750 Score = 56.6 bits (135), Expect = 9e-07 Identities = 29/36 (80%), Positives = 31/36 (86%), Gaps = 4/36 (11%) Frame = -1 Query: 393 PILLSPAFR----RIRSYQDLNAPEDEVTVLDYRSL 298 PILLSPAFR RIRSYQDL+ PEDEVTV+DYRSL Sbjct: 715 PILLSPAFRQDPRRIRSYQDLDVPEDEVTVIDYRSL 750 >XP_006384745.1 hypothetical protein POPTR_0004s20730g [Populus trichocarpa] ERP62542.1 hypothetical protein POPTR_0004s20730g [Populus trichocarpa] Length = 750 Score = 56.6 bits (135), Expect = 9e-07 Identities = 29/36 (80%), Positives = 31/36 (86%), Gaps = 4/36 (11%) Frame = -1 Query: 393 PILLSPAFR----RIRSYQDLNAPEDEVTVLDYRSL 298 PILLSPAFR RIRSYQDL+ PEDEVTV+DYRSL Sbjct: 715 PILLSPAFRQDPRRIRSYQDLDVPEDEVTVIDYRSL 750 >XP_010473101.1 PREDICTED: serrate RNA effector molecule-like [Camelina sativa] Length = 180 Score = 54.3 bits (129), Expect = 2e-06 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 4/36 (11%) Frame = -1 Query: 393 PILLSPAFR----RIRSYQDLNAPEDEVTVLDYRSL 298 P LLSPAFR R+RSYQDL+APE+EVTV+DYRSL Sbjct: 145 PFLLSPAFRQDPRRLRSYQDLDAPEEEVTVIDYRSL 180 >XP_008349834.1 PREDICTED: serrate RNA effector molecule-like [Malus domestica] XP_008349835.1 PREDICTED: serrate RNA effector molecule-like [Malus domestica] XP_008366392.1 PREDICTED: serrate RNA effector molecule-like [Malus domestica] XP_008366393.1 PREDICTED: serrate RNA effector molecule-like [Malus domestica] Length = 134 Score = 52.8 bits (125), Expect = 4e-06 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 5/37 (13%) Frame = -1 Query: 393 PIL-LSPAFR----RIRSYQDLNAPEDEVTVLDYRSL 298 PIL LSPAFR R+RSYQDL+APEDEVTV+DYRSL Sbjct: 98 PILALSPAFRQDPRRLRSYQDLDAPEDEVTVIDYRSL 134 >XP_018461565.1 PREDICTED: serrate RNA effector molecule-like [Raphanus sativus] Length = 686 Score = 54.3 bits (129), Expect = 6e-06 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 4/36 (11%) Frame = -1 Query: 393 PILLSPAFR----RIRSYQDLNAPEDEVTVLDYRSL 298 P LLSPAFR R+RSYQDL+APE+EVTV+DYRSL Sbjct: 651 PFLLSPAFRQDPRRLRSYQDLDAPEEEVTVIDYRSL 686 >XP_018484894.1 PREDICTED: serrate RNA effector molecule-like [Raphanus sativus] Length = 687 Score = 54.3 bits (129), Expect = 6e-06 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 4/36 (11%) Frame = -1 Query: 393 PILLSPAFR----RIRSYQDLNAPEDEVTVLDYRSL 298 P LLSPAFR R+RSYQDL+APE+EVTV+DYRSL Sbjct: 652 PFLLSPAFRQDPRRLRSYQDLDAPEEEVTVIDYRSL 687