BLASTX nr result
ID: Phellodendron21_contig00031830
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00031830 (288 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007407971.1 hypothetical protein MELLADRAFT_115872 [Melampsor... 74 3e-13 XP_007879269.1 hypothetical protein PFL1_03558 [Anthracocystis f... 54 3e-06 >XP_007407971.1 hypothetical protein MELLADRAFT_115872 [Melampsora larici-populina 98AG31] EGG08997.1 hypothetical protein MELLADRAFT_115872 [Melampsora larici-populina 98AG31] Length = 416 Score = 73.6 bits (179), Expect = 3e-13 Identities = 35/54 (64%), Positives = 39/54 (72%) Frame = -2 Query: 281 PPPTAPASKPGASAIPNYVPVGERKAVHPSWEAKVKQQEALAKAVPTGKKIVFD 120 PPP + + PN P+G+RKAVHPSWEAKVKQQ ALA AVP GKKIVFD Sbjct: 363 PPPKSIDTTKSNLPNPNLAPIGQRKAVHPSWEAKVKQQAALASAVPKGKKIVFD 416 >XP_007879269.1 hypothetical protein PFL1_03558 [Anthracocystis flocculosa PF-1] EPQ28755.1 hypothetical protein PFL1_03558 [Anthracocystis flocculosa PF-1] Length = 672 Score = 53.5 bits (127), Expect = 3e-06 Identities = 27/55 (49%), Positives = 34/55 (61%) Frame = -2 Query: 284 APPPTAPASKPGASAIPNYVPVGERKAVHPSWEAKVKQQEALAKAVPTGKKIVFD 120 APPP PAS P ASA + +++ +HPSW AK +Q+E A P GKKI FD Sbjct: 622 APPPARPASTPAASAGAS----SKKEEMHPSWIAKQRQKELAAATKPAGKKITFD 672