BLASTX nr result
ID: Phellodendron21_contig00031781
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00031781 (485 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007412743.1 hypothetical protein MELLADRAFT_78452 [Melampsora... 60 3e-08 >XP_007412743.1 hypothetical protein MELLADRAFT_78452 [Melampsora larici-populina 98AG31] EGG03950.1 hypothetical protein MELLADRAFT_78452 [Melampsora larici-populina 98AG31] Length = 153 Score = 59.7 bits (143), Expect = 3e-08 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = +1 Query: 349 PIVVSPYEPYSPNYRAAQKNEQAYNKVIIKEGQSEEKKLKEAIKE 483 P SP EP SP +AA KNE+AYNKV+IKE ++EEKK+K AIK+ Sbjct: 20 PAPTSPMEPQSPASKAALKNEKAYNKVLIKEAKAEEKKIKNAIKD 64