BLASTX nr result
ID: Phellodendron21_contig00031761
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00031761 (338 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006475079.1 PREDICTED: calcium-dependent protein kinase 33-li... 84 9e-17 XP_015384655.1 PREDICTED: calcium-dependent protein kinase 9-lik... 80 3e-16 XP_006452356.1 hypothetical protein CICLE_v10010666mg [Citrus cl... 82 6e-16 XP_006475078.1 PREDICTED: calcium-dependent protein kinase 33-li... 80 3e-15 KDO62708.1 hypothetical protein CISIN_1g018604mg [Citrus sinensis] 72 1e-12 XP_006452350.1 hypothetical protein CICLE_v10007950mg [Citrus cl... 72 2e-12 XP_006452359.1 hypothetical protein CICLE_v10007873mg [Citrus cl... 72 2e-12 XP_006452347.1 hypothetical protein CICLE_v10008020mg [Citrus cl... 71 4e-12 KDO62709.1 hypothetical protein CISIN_1g010756mg [Citrus sinensis] 70 9e-12 XP_006452360.1 hypothetical protein CICLE_v10010555mg [Citrus cl... 70 9e-12 XP_015384646.1 PREDICTED: calcium-dependent protein kinase 2-lik... 70 1e-11 XP_006452345.1 hypothetical protein CICLE_v10007978mg [Citrus cl... 66 2e-10 XP_006452344.1 hypothetical protein CICLE_v10007980mg [Citrus cl... 65 7e-10 KDO62703.1 hypothetical protein CISIN_1g009382mg [Citrus sinensis] 65 7e-10 KDO37230.1 hypothetical protein CISIN_1g047606mg [Citrus sinensis] 58 2e-07 KDO62705.1 hypothetical protein CISIN_1g040917mg, partial [Citru... 57 3e-07 XP_006452355.1 hypothetical protein CICLE_v10010314mg, partial [... 57 3e-07 KDO62717.1 hypothetical protein CISIN_1g0485941mg, partial [Citr... 54 4e-06 XP_006452369.1 hypothetical protein CICLE_v10010376mg [Citrus cl... 54 6e-06 >XP_006475079.1 PREDICTED: calcium-dependent protein kinase 33-like [Citrus sinensis] Length = 504 Score = 84.3 bits (207), Expect = 9e-17 Identities = 41/49 (83%), Positives = 44/49 (89%), Gaps = 4/49 (8%) Frame = -3 Query: 336 DIMSEVDRDKDGRISYDEFCAMMKRG----EFSSRSLSHVITLRRKIFW 202 +IMSEVDRDKDGRISYDEFCAMMKRG EFSSRSLSHV+T+RRKI W Sbjct: 456 EIMSEVDRDKDGRISYDEFCAMMKRGTQPREFSSRSLSHVVTMRRKILW 504 >XP_015384655.1 PREDICTED: calcium-dependent protein kinase 9-like [Citrus sinensis] Length = 204 Score = 80.1 bits (196), Expect = 3e-16 Identities = 41/69 (59%), Positives = 52/69 (75%), Gaps = 4/69 (5%) Frame = -3 Query: 336 DIMSEVDRDKDGRISYDEFCAMMKRG----EFSSRSLSHVITLRRKIFW*VNVLFLVLCR 169 +IMSEVDRDKDGRISYDEF +MMK G SSRSL+HV+T+RRK+FW VN C Sbjct: 106 EIMSEVDRDKDGRISYDEFRSMMKCGTQLRALSSRSLAHVVTVRRKVFWYVN------CV 159 Query: 168 IVQKYLFIF 142 ++ ++L+IF Sbjct: 160 VIHRFLYIF 168 >XP_006452356.1 hypothetical protein CICLE_v10010666mg [Citrus clementina] ESR65596.1 hypothetical protein CICLE_v10010666mg [Citrus clementina] Length = 491 Score = 82.0 bits (201), Expect = 6e-16 Identities = 40/49 (81%), Positives = 43/49 (87%), Gaps = 4/49 (8%) Frame = -3 Query: 336 DIMSEVDRDKDGRISYDEFCAMMKRG----EFSSRSLSHVITLRRKIFW 202 +IMSEVDRDKDGRISYDEFCAMMK G EFSSRSLSHV+T+RRKI W Sbjct: 443 EIMSEVDRDKDGRISYDEFCAMMKSGTQPREFSSRSLSHVVTMRRKILW 491 >XP_006475078.1 PREDICTED: calcium-dependent protein kinase 33-like [Citrus sinensis] Length = 551 Score = 80.1 bits (196), Expect = 3e-15 Identities = 41/69 (59%), Positives = 52/69 (75%), Gaps = 4/69 (5%) Frame = -3 Query: 336 DIMSEVDRDKDGRISYDEFCAMMKRG----EFSSRSLSHVITLRRKIFW*VNVLFLVLCR 169 +IMSEVDRDKDGRISYDEF +MMK G SSRSL+HV+T+RRK+FW VN C Sbjct: 453 EIMSEVDRDKDGRISYDEFRSMMKCGTQLRALSSRSLAHVVTVRRKVFWYVN------CV 506 Query: 168 IVQKYLFIF 142 ++ ++L+IF Sbjct: 507 VIHRFLYIF 515 >KDO62708.1 hypothetical protein CISIN_1g018604mg [Citrus sinensis] Length = 353 Score = 72.0 bits (175), Expect = 1e-12 Identities = 35/46 (76%), Positives = 40/46 (86%), Gaps = 4/46 (8%) Frame = -3 Query: 336 DIMSEVDRDKDGRISYDEFCAMMKRGE----FSSRSLSHVITLRRK 211 +IMSEVDRDKDGRISYDEFCAMMKRG F+SRSL+HV+T+R K Sbjct: 307 EIMSEVDRDKDGRISYDEFCAMMKRGTQRRGFASRSLAHVVTMRHK 352 >XP_006452350.1 hypothetical protein CICLE_v10007950mg [Citrus clementina] ESR65590.1 hypothetical protein CICLE_v10007950mg [Citrus clementina] Length = 538 Score = 72.0 bits (175), Expect = 2e-12 Identities = 35/46 (76%), Positives = 40/46 (86%), Gaps = 4/46 (8%) Frame = -3 Query: 336 DIMSEVDRDKDGRISYDEFCAMMKRGE----FSSRSLSHVITLRRK 211 +IMSEVDRDKDGRISYDEFCAMMKRG F+SRSL+HV+T+R K Sbjct: 492 EIMSEVDRDKDGRISYDEFCAMMKRGTQRLGFASRSLAHVVTMRHK 537 >XP_006452359.1 hypothetical protein CICLE_v10007873mg [Citrus clementina] ESR65599.1 hypothetical protein CICLE_v10007873mg [Citrus clementina] Length = 566 Score = 72.0 bits (175), Expect = 2e-12 Identities = 35/46 (76%), Positives = 40/46 (86%), Gaps = 4/46 (8%) Frame = -3 Query: 336 DIMSEVDRDKDGRISYDEFCAMMKRGE----FSSRSLSHVITLRRK 211 +IMSEVDRDKDGRISYDEFCAMMKRG F+SRSL+HV+T+R K Sbjct: 520 EIMSEVDRDKDGRISYDEFCAMMKRGTQRRGFASRSLAHVVTMRHK 565 >XP_006452347.1 hypothetical protein CICLE_v10008020mg [Citrus clementina] ESR65587.1 hypothetical protein CICLE_v10008020mg [Citrus clementina] KDO62706.1 hypothetical protein CISIN_1g010164mg [Citrus sinensis] Length = 516 Score = 71.2 bits (173), Expect = 4e-12 Identities = 35/49 (71%), Positives = 41/49 (83%), Gaps = 4/49 (8%) Frame = -3 Query: 336 DIMSEVDRDKDGRISYDEFCAMMKRG----EFSSRSLSHVITLRRKIFW 202 +IMSEVDRDKDGRISYDEF +MMK G SSRSL+HV+T+RRK+FW Sbjct: 468 EIMSEVDRDKDGRISYDEFRSMMKCGTQLRALSSRSLAHVVTVRRKVFW 516 >KDO62709.1 hypothetical protein CISIN_1g010756mg [Citrus sinensis] Length = 502 Score = 70.1 bits (170), Expect = 9e-12 Identities = 34/44 (77%), Positives = 39/44 (88%), Gaps = 4/44 (9%) Frame = -3 Query: 336 DIMSEVDRDKDGRISYDEFCAMMKRGE----FSSRSLSHVITLR 217 +IMSEVDRDKDGRISYDEFCAMMKRG F+SRSL+HV+T+R Sbjct: 458 EIMSEVDRDKDGRISYDEFCAMMKRGTQRRGFASRSLAHVVTMR 501 >XP_006452360.1 hypothetical protein CICLE_v10010555mg [Citrus clementina] ESR65600.1 hypothetical protein CICLE_v10010555mg [Citrus clementina] Length = 502 Score = 70.1 bits (170), Expect = 9e-12 Identities = 34/44 (77%), Positives = 39/44 (88%), Gaps = 4/44 (9%) Frame = -3 Query: 336 DIMSEVDRDKDGRISYDEFCAMMKRGE----FSSRSLSHVITLR 217 +IMSEVDRDKDGRISYDEFCAMMKRG F+SRSL+HV+T+R Sbjct: 458 EIMSEVDRDKDGRISYDEFCAMMKRGTQRRGFASRSLAHVVTMR 501 >XP_015384646.1 PREDICTED: calcium-dependent protein kinase 2-like [Citrus sinensis] Length = 530 Score = 69.7 bits (169), Expect = 1e-11 Identities = 35/49 (71%), Positives = 39/49 (79%), Gaps = 4/49 (8%) Frame = -3 Query: 336 DIMSEVDRDKDGRISYDEFCAMMKRG----EFSSRSLSHVITLRRKIFW 202 +IMSEVDRDKDGRISYDEF AMMK G SSR L+HV+ +RRKIFW Sbjct: 440 EIMSEVDRDKDGRISYDEFRAMMKSGTHLQAVSSRPLAHVVAIRRKIFW 488 >XP_006452345.1 hypothetical protein CICLE_v10007978mg [Citrus clementina] XP_006475077.1 PREDICTED: calcium-dependent protein kinase 33 [Citrus sinensis] ESR65585.1 hypothetical protein CICLE_v10007978mg [Citrus clementina] KDO62704.1 hypothetical protein CISIN_1g009561mg [Citrus sinensis] Length = 532 Score = 66.2 bits (160), Expect = 2e-10 Identities = 34/49 (69%), Positives = 38/49 (77%), Gaps = 4/49 (8%) Frame = -3 Query: 336 DIMSEVDRDKDGRISYDEFCAMMKR----GEFSSRSLSHVITLRRKIFW 202 +IMSEVDRDKDGRISYDEF AMMK SSRSL+HV+ +R KIFW Sbjct: 484 EIMSEVDRDKDGRISYDEFRAMMKSRTHLQAVSSRSLAHVVAIRSKIFW 532 >XP_006452344.1 hypothetical protein CICLE_v10007980mg [Citrus clementina] XP_006475076.1 PREDICTED: calcium-dependent protein kinase 33-like [Citrus sinensis] ESR65584.1 hypothetical protein CICLE_v10007980mg [Citrus clementina] Length = 531 Score = 64.7 bits (156), Expect = 7e-10 Identities = 36/49 (73%), Positives = 40/49 (81%), Gaps = 5/49 (10%) Frame = -3 Query: 336 DIMSEVDRDKDGRISYDEFCAMMKRG----EFSSRSLSHVITL-RRKIF 205 +IMSEVDRDKDGRISYDEF AMMK G SSRSL+HV+T+ RRKIF Sbjct: 482 EIMSEVDRDKDGRISYDEFRAMMKSGTHLRAVSSRSLAHVVTIRRRKIF 530 >KDO62703.1 hypothetical protein CISIN_1g009382mg [Citrus sinensis] Length = 536 Score = 64.7 bits (156), Expect = 7e-10 Identities = 36/49 (73%), Positives = 40/49 (81%), Gaps = 5/49 (10%) Frame = -3 Query: 336 DIMSEVDRDKDGRISYDEFCAMMKRG----EFSSRSLSHVITL-RRKIF 205 +IMSEVDRDKDGRISYDEF AMMK G SSRSL+HV+T+ RRKIF Sbjct: 487 EIMSEVDRDKDGRISYDEFRAMMKSGTHLRAVSSRSLAHVVTIRRRKIF 535 >KDO37230.1 hypothetical protein CISIN_1g047606mg [Citrus sinensis] Length = 476 Score = 57.8 bits (138), Expect = 2e-07 Identities = 30/45 (66%), Positives = 31/45 (68%) Frame = -3 Query: 336 DIMSEVDRDKDGRISYDEFCAMMKRGEFSSRSLSHVITLRRKIFW 202 +IMSEVDRDKDGRISYDEFCAMMKRG T RKI W Sbjct: 443 EIMSEVDRDKDGRISYDEFCAMMKRG-----------TQPRKILW 476 >KDO62705.1 hypothetical protein CISIN_1g040917mg, partial [Citrus sinensis] Length = 494 Score = 57.4 bits (137), Expect = 3e-07 Identities = 30/42 (71%), Positives = 34/42 (80%), Gaps = 4/42 (9%) Frame = -3 Query: 336 DIMSEVDRDKDGRISYDEFCAMMKRG----EFSSRSLSHVIT 223 +IMSEVDRDKDGRISYDEF +MMK G SSRSL+HV+T Sbjct: 453 EIMSEVDRDKDGRISYDEFRSMMKCGTQLRALSSRSLAHVVT 494 >XP_006452355.1 hypothetical protein CICLE_v10010314mg, partial [Citrus clementina] ESR65595.1 hypothetical protein CICLE_v10010314mg, partial [Citrus clementina] Length = 494 Score = 57.4 bits (137), Expect = 3e-07 Identities = 30/42 (71%), Positives = 34/42 (80%), Gaps = 4/42 (9%) Frame = -3 Query: 336 DIMSEVDRDKDGRISYDEFCAMMKRG----EFSSRSLSHVIT 223 +IMSEVDRDKDGRISYDEF +MMK G SSRSL+HV+T Sbjct: 453 EIMSEVDRDKDGRISYDEFRSMMKCGTQLRALSSRSLAHVVT 494 >KDO62717.1 hypothetical protein CISIN_1g0485941mg, partial [Citrus sinensis] Length = 262 Score = 53.5 bits (127), Expect = 4e-06 Identities = 28/48 (58%), Positives = 33/48 (68%), Gaps = 4/48 (8%) Frame = -3 Query: 336 DIMSEVDRDKDGRISYDEFCAMMKRGEF----SSRSLSHVITLRRKIF 205 +IM EVDRDKDGRISY+EFCA MK G S R+LSH+ + K F Sbjct: 212 EIMFEVDRDKDGRISYEEFCATMKTGTHLRGTSYRNLSHIFIGKGKTF 259 >XP_006452369.1 hypothetical protein CICLE_v10010376mg [Citrus clementina] ESR65609.1 hypothetical protein CICLE_v10010376mg [Citrus clementina] Length = 491 Score = 53.5 bits (127), Expect = 6e-06 Identities = 28/48 (58%), Positives = 33/48 (68%), Gaps = 4/48 (8%) Frame = -3 Query: 336 DIMSEVDRDKDGRISYDEFCAMMKRGEF----SSRSLSHVITLRRKIF 205 +IM EVDRDKDGRISY+EFCA MK G S R+LSH+ + K F Sbjct: 441 EIMFEVDRDKDGRISYEEFCATMKTGTHLRGTSYRNLSHIFIGKGKTF 488