BLASTX nr result
ID: Phellodendron21_contig00031610
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00031610 (262 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO79017.1 hypothetical protein CISIN_1g035500mg [Citrus sinensis] 62 3e-09 XP_006426028.1 hypothetical protein CICLE_v10024935mg [Citrus cl... 62 3e-09 XP_015388695.1 PREDICTED: uncharacterized protein LOC102618276 i... 62 3e-09 XP_006426029.1 hypothetical protein CICLE_v10024935mg [Citrus cl... 62 3e-09 XP_015388690.1 PREDICTED: uncharacterized protein LOC102618276 i... 62 3e-09 XP_006426030.1 hypothetical protein CICLE_v10024935mg [Citrus cl... 62 3e-09 >KDO79017.1 hypothetical protein CISIN_1g035500mg [Citrus sinensis] Length = 606 Score = 62.0 bits (149), Expect = 3e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +3 Query: 144 MSMNISTLEARYLESCSRRETQPNSSVLSWFSE 242 M+M++STLEARYL+SC RRETQPNSSVLSWFSE Sbjct: 1 MAMDMSTLEARYLDSCRRRETQPNSSVLSWFSE 33 >XP_006426028.1 hypothetical protein CICLE_v10024935mg [Citrus clementina] ESR39268.1 hypothetical protein CICLE_v10024935mg [Citrus clementina] Length = 739 Score = 62.0 bits (149), Expect = 3e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +3 Query: 144 MSMNISTLEARYLESCSRRETQPNSSVLSWFSE 242 M+M++STLEARYL+SC RRETQPNSSVLSWFSE Sbjct: 1 MAMDMSTLEARYLDSCRRRETQPNSSVLSWFSE 33 >XP_015388695.1 PREDICTED: uncharacterized protein LOC102618276 isoform X2 [Citrus sinensis] Length = 767 Score = 62.0 bits (149), Expect = 3e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +3 Query: 144 MSMNISTLEARYLESCSRRETQPNSSVLSWFSE 242 M+M++STLEARYL+SC RRETQPNSSVLSWFSE Sbjct: 1 MAMDMSTLEARYLDSCRRRETQPNSSVLSWFSE 33 >XP_006426029.1 hypothetical protein CICLE_v10024935mg [Citrus clementina] ESR39269.1 hypothetical protein CICLE_v10024935mg [Citrus clementina] Length = 767 Score = 62.0 bits (149), Expect = 3e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +3 Query: 144 MSMNISTLEARYLESCSRRETQPNSSVLSWFSE 242 M+M++STLEARYL+SC RRETQPNSSVLSWFSE Sbjct: 1 MAMDMSTLEARYLDSCRRRETQPNSSVLSWFSE 33 >XP_015388690.1 PREDICTED: uncharacterized protein LOC102618276 isoform X1 [Citrus sinensis] Length = 776 Score = 62.0 bits (149), Expect = 3e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +3 Query: 144 MSMNISTLEARYLESCSRRETQPNSSVLSWFSE 242 M+M++STLEARYL+SC RRETQPNSSVLSWFSE Sbjct: 1 MAMDMSTLEARYLDSCRRRETQPNSSVLSWFSE 33 >XP_006426030.1 hypothetical protein CICLE_v10024935mg [Citrus clementina] ESR39270.1 hypothetical protein CICLE_v10024935mg [Citrus clementina] Length = 776 Score = 62.0 bits (149), Expect = 3e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +3 Query: 144 MSMNISTLEARYLESCSRRETQPNSSVLSWFSE 242 M+M++STLEARYL+SC RRETQPNSSVLSWFSE Sbjct: 1 MAMDMSTLEARYLDSCRRRETQPNSSVLSWFSE 33