BLASTX nr result
ID: Phellodendron21_contig00031607
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00031607 (271 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006437911.1 hypothetical protein CICLE_v100311322mg, partial ... 103 6e-25 KDO70348.1 hypothetical protein CISIN_1g0072551mg, partial [Citr... 103 1e-24 XP_006437912.1 hypothetical protein CICLE_v100311322mg, partial ... 103 3e-24 XP_006484222.1 PREDICTED: cell division control protein 48 homol... 103 5e-24 XP_010091587.1 Cell division control protein 48-B-like protein [... 96 4e-21 XP_018818455.1 PREDICTED: cell division control protein 48 homol... 90 4e-19 GAV83867.1 AAA domain-containing protein [Cephalotus follicularis] 89 1e-18 ONI31026.1 hypothetical protein PRUPE_1G288400 [Prunus persica] 88 2e-18 XP_007226480.1 hypothetical protein PRUPE_ppa026942mg, partial [... 88 2e-18 ONI31031.1 hypothetical protein PRUPE_1G288400 [Prunus persica] 88 2e-18 XP_012066248.1 PREDICTED: cell division control protein 48 homol... 88 2e-18 XP_008243836.1 PREDICTED: cell division control protein 48 homol... 88 2e-18 OMP05399.1 hypothetical protein CCACVL1_01922 [Corchorus capsula... 87 3e-18 XP_010258026.1 PREDICTED: cell division control protein 48 homol... 87 5e-18 OMO72034.1 hypothetical protein COLO4_27870 [Corchorus olitorius] 87 6e-18 XP_008339797.1 PREDICTED: cell division control protein 48 homol... 86 1e-17 XP_007045845.2 PREDICTED: cell division control protein 48 homol... 85 2e-17 EOY01677.1 Cell division control protein 48 B [Theobroma cacao] 85 2e-17 XP_015895164.1 PREDICTED: cell division control protein 48 homol... 85 3e-17 XP_015895162.1 PREDICTED: cell division control protein 48 homol... 85 3e-17 >XP_006437911.1 hypothetical protein CICLE_v100311322mg, partial [Citrus clementina] ESR51151.1 hypothetical protein CICLE_v100311322mg, partial [Citrus clementina] Length = 312 Score = 103 bits (258), Expect = 6e-25 Identities = 48/50 (96%), Positives = 50/50 (100%) Frame = -2 Query: 270 DANECAGVLSVTMEDWKHARTVVGPSITRGVTVEIPKVTWEDIGGLRDLK 121 DANECAGVLSVTMEDW+HAR+VVGPSITRGVTVEIPKVTWEDIGGLRDLK Sbjct: 115 DANECAGVLSVTMEDWRHARSVVGPSITRGVTVEIPKVTWEDIGGLRDLK 164 >KDO70348.1 hypothetical protein CISIN_1g0072551mg, partial [Citrus sinensis] KDO70349.1 hypothetical protein CISIN_1g0072551mg, partial [Citrus sinensis] Length = 355 Score = 103 bits (258), Expect = 1e-24 Identities = 48/50 (96%), Positives = 50/50 (100%) Frame = -2 Query: 270 DANECAGVLSVTMEDWKHARTVVGPSITRGVTVEIPKVTWEDIGGLRDLK 121 DANECAGVLSVTMEDW+HAR+VVGPSITRGVTVEIPKVTWEDIGGLRDLK Sbjct: 250 DANECAGVLSVTMEDWRHARSVVGPSITRGVTVEIPKVTWEDIGGLRDLK 299 >XP_006437912.1 hypothetical protein CICLE_v100311322mg, partial [Citrus clementina] ESR51152.1 hypothetical protein CICLE_v100311322mg, partial [Citrus clementina] Length = 476 Score = 103 bits (258), Expect = 3e-24 Identities = 48/50 (96%), Positives = 50/50 (100%) Frame = -2 Query: 270 DANECAGVLSVTMEDWKHARTVVGPSITRGVTVEIPKVTWEDIGGLRDLK 121 DANECAGVLSVTMEDW+HAR+VVGPSITRGVTVEIPKVTWEDIGGLRDLK Sbjct: 115 DANECAGVLSVTMEDWRHARSVVGPSITRGVTVEIPKVTWEDIGGLRDLK 164 >XP_006484222.1 PREDICTED: cell division control protein 48 homolog B [Citrus sinensis] Length = 611 Score = 103 bits (258), Expect = 5e-24 Identities = 48/50 (96%), Positives = 50/50 (100%) Frame = -2 Query: 270 DANECAGVLSVTMEDWKHARTVVGPSITRGVTVEIPKVTWEDIGGLRDLK 121 DANECAGVLSVTMEDW+HAR+VVGPSITRGVTVEIPKVTWEDIGGLRDLK Sbjct: 250 DANECAGVLSVTMEDWRHARSVVGPSITRGVTVEIPKVTWEDIGGLRDLK 299 >XP_010091587.1 Cell division control protein 48-B-like protein [Morus notabilis] EXB44853.1 Cell division control protein 48-B-like protein [Morus notabilis] Length = 616 Score = 95.9 bits (237), Expect = 4e-21 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = -2 Query: 270 DANECAGVLSVTMEDWKHARTVVGPSITRGVTVEIPKVTWEDIGGLRDLK 121 DA+E AG S+TMEDWKHARTVVGPSITRGVTVEIPKVTWEDIGGLRDLK Sbjct: 254 DASEDAGAFSLTMEDWKHARTVVGPSITRGVTVEIPKVTWEDIGGLRDLK 303 >XP_018818455.1 PREDICTED: cell division control protein 48 homolog B-like [Juglans regia] Length = 611 Score = 90.1 bits (222), Expect = 4e-19 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = -2 Query: 270 DANECAGVLSVTMEDWKHARTVVGPSITRGVTVEIPKVTWEDIGGLRDLK 121 DAN GVLS+TM DWKHA+++VGPSITRGVTVEIPKVTWEDIGGL+DLK Sbjct: 253 DANGSVGVLSLTMGDWKHAQSIVGPSITRGVTVEIPKVTWEDIGGLKDLK 302 >GAV83867.1 AAA domain-containing protein [Cephalotus follicularis] Length = 665 Score = 89.0 bits (219), Expect = 1e-18 Identities = 40/50 (80%), Positives = 47/50 (94%) Frame = -2 Query: 270 DANECAGVLSVTMEDWKHARTVVGPSITRGVTVEIPKVTWEDIGGLRDLK 121 DANE VLS+++EDWKHAR++VGPSITRGVTVEIPKV+WEDIGGL+DLK Sbjct: 305 DANEDTDVLSLSVEDWKHARSIVGPSITRGVTVEIPKVSWEDIGGLKDLK 354 >ONI31026.1 hypothetical protein PRUPE_1G288400 [Prunus persica] Length = 500 Score = 88.2 bits (217), Expect = 2e-18 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = -2 Query: 267 ANECAGVLSVTMEDWKHARTVVGPSITRGVTVEIPKVTWEDIGGLRDLK 121 AN+ AGV S+T EDWKHAR+VV PSITRGVTVEIPKVTWEDIGGL+DLK Sbjct: 200 ANKDAGVFSLTTEDWKHARSVVSPSITRGVTVEIPKVTWEDIGGLKDLK 248 >XP_007226480.1 hypothetical protein PRUPE_ppa026942mg, partial [Prunus persica] Length = 555 Score = 88.2 bits (217), Expect = 2e-18 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = -2 Query: 267 ANECAGVLSVTMEDWKHARTVVGPSITRGVTVEIPKVTWEDIGGLRDLK 121 AN+ AGV S+T EDWKHAR+VV PSITRGVTVEIPKVTWEDIGGL+DLK Sbjct: 258 ANKDAGVFSLTTEDWKHARSVVSPSITRGVTVEIPKVTWEDIGGLKDLK 306 >ONI31031.1 hypothetical protein PRUPE_1G288400 [Prunus persica] Length = 558 Score = 88.2 bits (217), Expect = 2e-18 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = -2 Query: 267 ANECAGVLSVTMEDWKHARTVVGPSITRGVTVEIPKVTWEDIGGLRDLK 121 AN+ AGV S+T EDWKHAR+VV PSITRGVTVEIPKVTWEDIGGL+DLK Sbjct: 258 ANKDAGVFSLTTEDWKHARSVVSPSITRGVTVEIPKVTWEDIGGLKDLK 306 >XP_012066248.1 PREDICTED: cell division control protein 48 homolog B [Jatropha curcas] XP_012066249.1 PREDICTED: cell division control protein 48 homolog B [Jatropha curcas] KDP42873.1 hypothetical protein JCGZ_23815 [Jatropha curcas] Length = 615 Score = 88.2 bits (217), Expect = 2e-18 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = -2 Query: 270 DANECAGVLSVTMEDWKHARTVVGPSITRGVTVEIPKVTWEDIGGLRDLK 121 +ANE AGV +TMEDWK AR+VVGPSITRGVTVE+PKV+WEDIGGL+DLK Sbjct: 257 EANENAGVFRLTMEDWKRARSVVGPSITRGVTVEVPKVSWEDIGGLKDLK 306 >XP_008243836.1 PREDICTED: cell division control protein 48 homolog B [Prunus mume] Length = 558 Score = 87.8 bits (216), Expect = 2e-18 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = -2 Query: 267 ANECAGVLSVTMEDWKHARTVVGPSITRGVTVEIPKVTWEDIGGLRDLK 121 AN+ AGV S+T EDWKHAR+VV PS+TRGVTVEIPKVTWEDIGGL+DLK Sbjct: 258 ANKDAGVFSLTTEDWKHARSVVSPSVTRGVTVEIPKVTWEDIGGLKDLK 306 >OMP05399.1 hypothetical protein CCACVL1_01922 [Corchorus capsularis] Length = 658 Score = 87.4 bits (215), Expect = 3e-18 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = -2 Query: 261 ECAGVLSVTMEDWKHARTVVGPSITRGVTVEIPKVTWEDIGGLRDLK 121 E GVLS+TMEDWKHA++VVGPSITRGVTVEIPKV+WEDIGGL+DLK Sbjct: 298 ENPGVLSLTMEDWKHAKSVVGPSITRGVTVEIPKVSWEDIGGLKDLK 344 >XP_010258026.1 PREDICTED: cell division control protein 48 homolog B [Nelumbo nucifera] Length = 603 Score = 87.0 bits (214), Expect = 5e-18 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = -2 Query: 270 DANECAGVLSVTMEDWKHARTVVGPSITRGVTVEIPKVTWEDIGGLRDLK 121 D + G+ S+TM+DWKHA+TVVGPSITRGVTVEIPKVTWEDIGGL+DLK Sbjct: 245 DVTKDGGLCSLTMDDWKHAKTVVGPSITRGVTVEIPKVTWEDIGGLQDLK 294 >OMO72034.1 hypothetical protein COLO4_27870 [Corchorus olitorius] Length = 624 Score = 86.7 bits (213), Expect = 6e-18 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = -2 Query: 270 DANECAGVLSVTMEDWKHARTVVGPSITRGVTVEIPKVTWEDIGGLRDLK 121 D E GVLS+TMEDWKHA++VVGPSITRGVTVEIPKV+WEDIGGL +LK Sbjct: 261 DIGENPGVLSLTMEDWKHAKSVVGPSITRGVTVEIPKVSWEDIGGLNNLK 310 >XP_008339797.1 PREDICTED: cell division control protein 48 homolog B [Malus domestica] Length = 555 Score = 85.9 bits (211), Expect = 1e-17 Identities = 39/50 (78%), Positives = 44/50 (88%) Frame = -2 Query: 270 DANECAGVLSVTMEDWKHARTVVGPSITRGVTVEIPKVTWEDIGGLRDLK 121 DAN+ A S+T+EDWKHAR+VV PSITRGVTVE+PKVTWEDIGGL DLK Sbjct: 254 DANKDAXAFSLTIEDWKHARSVVSPSITRGVTVEVPKVTWEDIGGLNDLK 303 >XP_007045845.2 PREDICTED: cell division control protein 48 homolog B [Theobroma cacao] Length = 618 Score = 85.1 bits (209), Expect = 2e-17 Identities = 38/50 (76%), Positives = 44/50 (88%) Frame = -2 Query: 270 DANECAGVLSVTMEDWKHARTVVGPSITRGVTVEIPKVTWEDIGGLRDLK 121 D E G L +TMEDWKHA++VVGPSITRGVTVEIPKV+WED+GGL+DLK Sbjct: 261 DIGENPGALILTMEDWKHAKSVVGPSITRGVTVEIPKVSWEDVGGLKDLK 310 >EOY01677.1 Cell division control protein 48 B [Theobroma cacao] Length = 618 Score = 85.1 bits (209), Expect = 2e-17 Identities = 38/50 (76%), Positives = 44/50 (88%) Frame = -2 Query: 270 DANECAGVLSVTMEDWKHARTVVGPSITRGVTVEIPKVTWEDIGGLRDLK 121 D E G L +TMEDWKHA++VVGPSITRGVTVEIPKV+WED+GGL+DLK Sbjct: 261 DIGENPGALILTMEDWKHAKSVVGPSITRGVTVEIPKVSWEDVGGLKDLK 310 >XP_015895164.1 PREDICTED: cell division control protein 48 homolog B isoform X3 [Ziziphus jujuba] Length = 516 Score = 84.7 bits (208), Expect = 3e-17 Identities = 39/50 (78%), Positives = 44/50 (88%) Frame = -2 Query: 270 DANECAGVLSVTMEDWKHARTVVGPSITRGVTVEIPKVTWEDIGGLRDLK 121 DAN A V+SV +EDW HAR+VVGPSITRGV V+IPKVTWEDIGGL+DLK Sbjct: 206 DANTDADVISVKLEDWDHARSVVGPSITRGVAVDIPKVTWEDIGGLKDLK 255 >XP_015895162.1 PREDICTED: cell division control protein 48 homolog B isoform X2 [Ziziphus jujuba] Length = 523 Score = 84.7 bits (208), Expect = 3e-17 Identities = 39/50 (78%), Positives = 44/50 (88%) Frame = -2 Query: 270 DANECAGVLSVTMEDWKHARTVVGPSITRGVTVEIPKVTWEDIGGLRDLK 121 DAN A V+SV +EDW HAR+VVGPSITRGV V+IPKVTWEDIGGL+DLK Sbjct: 256 DANTDADVISVKLEDWDHARSVVGPSITRGVAVDIPKVTWEDIGGLKDLK 305