BLASTX nr result
ID: Phellodendron21_contig00031604
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00031604 (390 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAC71568.1 membrane coat complex Retromer, subunit VPS26 [Moeszi... 106 1e-27 GAW03841.1 vacuolar protein sorting-associated protein 26 [Lenti... 106 5e-27 CCO27032.1 Vacuolar protein sorting-associated protein 26B-like ... 106 2e-26 XP_007406137.1 hypothetical protein MELLADRAFT_33670 [Melampsora... 108 2e-26 OAV94673.1 hypothetical protein PTTG_09606 [Puccinia triticina 1... 108 3e-26 KNE94590.1 vacuolar protein sorting-associated protein 26B-A [Pu... 108 3e-26 KIK61514.1 hypothetical protein GYMLUDRAFT_43074 [Gymnopus luxur... 108 5e-26 XP_007843470.1 vacuolar protein sorting-associated protein 26 [M... 108 5e-26 XP_007303660.1 vacuolar protein sorting-associated protein 26 [S... 108 5e-26 KNZ48412.1 hypothetical protein VP01_568g1 [Puccinia sorghi] 108 5e-26 KIJ16402.1 hypothetical protein PAXINDRAFT_168534 [Paxillus invo... 107 6e-26 XP_007317008.1 hypothetical protein SERLADRAFT_464351 [Serpula l... 107 6e-26 KYQ33441.1 Vacuolar protein sorting-associated protein 26B-like ... 107 6e-26 KIM74082.1 hypothetical protein PILCRDRAFT_828590 [Piloderma cro... 107 6e-26 KIK07075.1 hypothetical protein K443DRAFT_673648 [Laccaria ameth... 107 6e-26 XP_006455350.1 hypothetical protein AGABI2DRAFT_194951 [Agaricus... 107 6e-26 XP_007370581.1 vacuolar protein sorting-associated protein 26 [D... 107 6e-26 XP_007350422.1 vacuolar protein sorting-associated protein 26 [A... 107 6e-26 XP_008043390.1 vacuolar protein sorting-associated protein 26 [T... 107 6e-26 XP_001878768.1 predicted protein [Laccaria bicolor S238N-H82] ED... 107 6e-26 >GAC71568.1 membrane coat complex Retromer, subunit VPS26 [Moesziomyces antarcticus T-34] Length = 94 Score = 106 bits (265), Expect = 1e-27 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = -3 Query: 385 RLFLGGFDLTPTFRDINKKFSTRYYLNLVLIDEENRRYFKQQEITVFRLPEN 230 RLFLGGF+LTPTFRD+NKKFSTRYYLNLVLIDEENRRYFKQQEITVFR+PEN Sbjct: 43 RLFLGGFELTPTFRDVNKKFSTRYYLNLVLIDEENRRYFKQQEITVFRIPEN 94 >GAW03841.1 vacuolar protein sorting-associated protein 26 [Lentinula edodes] Length = 135 Score = 106 bits (264), Expect = 5e-27 Identities = 48/52 (92%), Positives = 52/52 (100%) Frame = -3 Query: 385 RLFLGGFDLTPTFRDINKKFSTRYYLNLVLIDEENRRYFKQQEITVFRLPEN 230 RLFLGGF+LTPTFRD+NKKFSTRYYLNLVLIDEENRRYFKQQEIT+FR+PEN Sbjct: 84 RLFLGGFELTPTFRDVNKKFSTRYYLNLVLIDEENRRYFKQQEITIFRIPEN 135 >CCO27032.1 Vacuolar protein sorting-associated protein 26B-like AltName: Full=Vesicle protein sorting 26B-like [Rhizoctonia solani AG-1 IB] Length = 200 Score = 106 bits (265), Expect = 2e-26 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = -3 Query: 385 RLFLGGFDLTPTFRDINKKFSTRYYLNLVLIDEENRRYFKQQEITVFRLPEN 230 RLFLGGF+LTPTFRD+NKKFSTRYYLNLVLIDEENRRYFKQQEITVFR+PEN Sbjct: 149 RLFLGGFELTPTFRDVNKKFSTRYYLNLVLIDEENRRYFKQQEITVFRIPEN 200 >XP_007406137.1 hypothetical protein MELLADRAFT_33670 [Melampsora larici-populina 98AG31] EGG10668.1 hypothetical protein MELLADRAFT_33670 [Melampsora larici-populina 98AG31] Length = 298 Score = 108 bits (271), Expect = 2e-26 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = -3 Query: 385 RLFLGGFDLTPTFRDINKKFSTRYYLNLVLIDEENRRYFKQQEITVFRLPEN 230 RLFLGGFDLTPTFRD+NKKFSTRYYLNLVLIDEENRRYFKQQEITVFRLPEN Sbjct: 247 RLFLGGFDLTPTFRDVNKKFSTRYYLNLVLIDEENRRYFKQQEITVFRLPEN 298 >OAV94673.1 hypothetical protein PTTG_09606 [Puccinia triticina 1-1 BBBD Race 1] Length = 298 Score = 108 bits (270), Expect = 3e-26 Identities = 50/52 (96%), Positives = 52/52 (100%) Frame = -3 Query: 385 RLFLGGFDLTPTFRDINKKFSTRYYLNLVLIDEENRRYFKQQEITVFRLPEN 230 RLFLGGFDLTPTFRD+NKKFSTRYYLNLVLIDEENRRYFKQQEIT+FRLPEN Sbjct: 247 RLFLGGFDLTPTFRDVNKKFSTRYYLNLVLIDEENRRYFKQQEITIFRLPEN 298 >KNE94590.1 vacuolar protein sorting-associated protein 26B-A [Puccinia striiformis f. sp. tritici PST-78] Length = 298 Score = 108 bits (270), Expect = 3e-26 Identities = 50/52 (96%), Positives = 52/52 (100%) Frame = -3 Query: 385 RLFLGGFDLTPTFRDINKKFSTRYYLNLVLIDEENRRYFKQQEITVFRLPEN 230 RLFLGGFDLTPTFRD+NKKFSTRYYLNLVLIDEENRRYFKQQEIT+FRLPEN Sbjct: 247 RLFLGGFDLTPTFRDVNKKFSTRYYLNLVLIDEENRRYFKQQEITIFRLPEN 298 >KIK61514.1 hypothetical protein GYMLUDRAFT_43074 [Gymnopus luxurians FD-317 M1] Length = 297 Score = 108 bits (269), Expect = 5e-26 Identities = 50/52 (96%), Positives = 52/52 (100%) Frame = -3 Query: 385 RLFLGGFDLTPTFRDINKKFSTRYYLNLVLIDEENRRYFKQQEITVFRLPEN 230 RLFLGGFDLTPTFRD+NKKFSTRYYLNLVLIDEENRRYFKQQEITVFR+PEN Sbjct: 246 RLFLGGFDLTPTFRDVNKKFSTRYYLNLVLIDEENRRYFKQQEITVFRIPEN 297 >XP_007843470.1 vacuolar protein sorting-associated protein 26 [Moniliophthora roreri MCA 2997] ESK97241.1 vacuolar protein sorting-associated protein 26 [Moniliophthora roreri MCA 2997] Length = 297 Score = 108 bits (269), Expect = 5e-26 Identities = 50/52 (96%), Positives = 52/52 (100%) Frame = -3 Query: 385 RLFLGGFDLTPTFRDINKKFSTRYYLNLVLIDEENRRYFKQQEITVFRLPEN 230 RLFLGGFDLTPTFRD+NKKFSTRYYLNLVLIDEENRRYFKQQEITVFR+PEN Sbjct: 246 RLFLGGFDLTPTFRDVNKKFSTRYYLNLVLIDEENRRYFKQQEITVFRIPEN 297 >XP_007303660.1 vacuolar protein sorting-associated protein 26 [Stereum hirsutum FP-91666 SS1] EIM87416.1 vacuolar protein sorting-associated protein 26 [Stereum hirsutum FP-91666 SS1] Length = 297 Score = 108 bits (269), Expect = 5e-26 Identities = 50/52 (96%), Positives = 52/52 (100%) Frame = -3 Query: 385 RLFLGGFDLTPTFRDINKKFSTRYYLNLVLIDEENRRYFKQQEITVFRLPEN 230 RLFLGGFDLTPTFRD+NKKFSTRYYLNLVLIDEENRRYFKQQEITVFR+PEN Sbjct: 246 RLFLGGFDLTPTFRDVNKKFSTRYYLNLVLIDEENRRYFKQQEITVFRIPEN 297 >KNZ48412.1 hypothetical protein VP01_568g1 [Puccinia sorghi] Length = 319 Score = 108 bits (270), Expect = 5e-26 Identities = 50/52 (96%), Positives = 52/52 (100%) Frame = -3 Query: 385 RLFLGGFDLTPTFRDINKKFSTRYYLNLVLIDEENRRYFKQQEITVFRLPEN 230 RLFLGGFDLTPTFRD+NKKFSTRYYLNLVLIDEENRRYFKQQEIT+FRLPEN Sbjct: 268 RLFLGGFDLTPTFRDVNKKFSTRYYLNLVLIDEENRRYFKQQEITIFRLPEN 319 >KIJ16402.1 hypothetical protein PAXINDRAFT_168534 [Paxillus involutus ATCC 200175] Length = 296 Score = 107 bits (268), Expect = 6e-26 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = -3 Query: 385 RLFLGGFDLTPTFRDINKKFSTRYYLNLVLIDEENRRYFKQQEITVFRLPEN 230 RLFLGGFDLTPTFRD+NKKFSTRYYLNLVLIDEENRRYFKQQEIT+FR+PEN Sbjct: 245 RLFLGGFDLTPTFRDVNKKFSTRYYLNLVLIDEENRRYFKQQEITIFRIPEN 296 >XP_007317008.1 hypothetical protein SERLADRAFT_464351 [Serpula lacrymans var. lacrymans S7.9] EGO01187.1 hypothetical protein SERLA73DRAFT_179292 [Serpula lacrymans var. lacrymans S7.3] EGO26835.1 hypothetical protein SERLADRAFT_464351 [Serpula lacrymans var. lacrymans S7.9] Length = 296 Score = 107 bits (268), Expect = 6e-26 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = -3 Query: 385 RLFLGGFDLTPTFRDINKKFSTRYYLNLVLIDEENRRYFKQQEITVFRLPEN 230 RLFLGGFDLTPTFRD+NKKFSTRYYLNLVLIDEENRRYFKQQEIT+FR+PEN Sbjct: 245 RLFLGGFDLTPTFRDVNKKFSTRYYLNLVLIDEENRRYFKQQEITIFRIPEN 296 >KYQ33441.1 Vacuolar protein sorting-associated protein 26B-like [Hypsizygus marmoreus] Length = 297 Score = 107 bits (268), Expect = 6e-26 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = -3 Query: 385 RLFLGGFDLTPTFRDINKKFSTRYYLNLVLIDEENRRYFKQQEITVFRLPEN 230 RLFLGGFDLTPTFRD+NKKFSTRYYLNLVLIDEENRRYFKQQEIT+FR+PEN Sbjct: 246 RLFLGGFDLTPTFRDVNKKFSTRYYLNLVLIDEENRRYFKQQEITIFRIPEN 297 >KIM74082.1 hypothetical protein PILCRDRAFT_828590 [Piloderma croceum F 1598] Length = 297 Score = 107 bits (268), Expect = 6e-26 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = -3 Query: 385 RLFLGGFDLTPTFRDINKKFSTRYYLNLVLIDEENRRYFKQQEITVFRLPEN 230 RLFLGGFDLTPTFRD+NKKFSTRYYLNLVLIDEENRRYFKQQEIT+FR+PEN Sbjct: 246 RLFLGGFDLTPTFRDVNKKFSTRYYLNLVLIDEENRRYFKQQEITIFRIPEN 297 >KIK07075.1 hypothetical protein K443DRAFT_673648 [Laccaria amethystina LaAM-08-1] Length = 297 Score = 107 bits (268), Expect = 6e-26 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = -3 Query: 385 RLFLGGFDLTPTFRDINKKFSTRYYLNLVLIDEENRRYFKQQEITVFRLPEN 230 RLFLGGFDLTPTFRD+NKKFSTRYYLNLVLIDEENRRYFKQQEIT+FR+PEN Sbjct: 246 RLFLGGFDLTPTFRDVNKKFSTRYYLNLVLIDEENRRYFKQQEITIFRIPEN 297 >XP_006455350.1 hypothetical protein AGABI2DRAFT_194951 [Agaricus bisporus var. bisporus H97] XP_007330849.1 hypothetical protein AGABI1DRAFT_60742 [Agaricus bisporus var. burnettii JB137-S8] EKM78517.1 hypothetical protein AGABI1DRAFT_60742 [Agaricus bisporus var. burnettii JB137-S8] EKV44087.1 hypothetical protein AGABI2DRAFT_194951 [Agaricus bisporus var. bisporus H97] Length = 297 Score = 107 bits (268), Expect = 6e-26 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = -3 Query: 385 RLFLGGFDLTPTFRDINKKFSTRYYLNLVLIDEENRRYFKQQEITVFRLPEN 230 RLFLGGFDLTPTFRD+NKKFSTRYYLNLVLIDEENRRYFKQQEIT+FR+PEN Sbjct: 246 RLFLGGFDLTPTFRDVNKKFSTRYYLNLVLIDEENRRYFKQQEITIFRIPEN 297 >XP_007370581.1 vacuolar protein sorting-associated protein 26 [Dichomitus squalens LYAD-421 SS1] EJF56718.1 vacuolar protein sorting-associated protein 26 [Dichomitus squalens LYAD-421 SS1] Length = 297 Score = 107 bits (268), Expect = 6e-26 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = -3 Query: 385 RLFLGGFDLTPTFRDINKKFSTRYYLNLVLIDEENRRYFKQQEITVFRLPEN 230 RLFLGGFDLTPTFRD+NKKFSTRYYLNLVLIDEENRRYFKQQEIT+FR+PEN Sbjct: 246 RLFLGGFDLTPTFRDVNKKFSTRYYLNLVLIDEENRRYFKQQEITIFRIPEN 297 >XP_007350422.1 vacuolar protein sorting-associated protein 26 [Auricularia subglabra TFB-10046 SS5] EJD41556.1 vacuolar protein sorting-associated protein 26 [Auricularia subglabra TFB-10046 SS5] Length = 297 Score = 107 bits (268), Expect = 6e-26 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = -3 Query: 385 RLFLGGFDLTPTFRDINKKFSTRYYLNLVLIDEENRRYFKQQEITVFRLPEN 230 RLFLGGFDLTPTFRD+NKKFSTRYYLNLVLIDEENRRYFKQQEIT+FR+PEN Sbjct: 246 RLFLGGFDLTPTFRDVNKKFSTRYYLNLVLIDEENRRYFKQQEITIFRIPEN 297 >XP_008043390.1 vacuolar protein sorting-associated protein 26 [Trametes versicolor FP-101664 SS1] EIW53450.1 vacuolar protein sorting-associated protein 26 [Trametes versicolor FP-101664 SS1] Length = 297 Score = 107 bits (268), Expect = 6e-26 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = -3 Query: 385 RLFLGGFDLTPTFRDINKKFSTRYYLNLVLIDEENRRYFKQQEITVFRLPEN 230 RLFLGGFDLTPTFRD+NKKFSTRYYLNLVLIDEENRRYFKQQEIT+FR+PEN Sbjct: 246 RLFLGGFDLTPTFRDVNKKFSTRYYLNLVLIDEENRRYFKQQEITIFRIPEN 297 >XP_001878768.1 predicted protein [Laccaria bicolor S238N-H82] EDR10318.1 predicted protein [Laccaria bicolor S238N-H82] Length = 297 Score = 107 bits (268), Expect = 6e-26 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = -3 Query: 385 RLFLGGFDLTPTFRDINKKFSTRYYLNLVLIDEENRRYFKQQEITVFRLPEN 230 RLFLGGFDLTPTFRD+NKKFSTRYYLNLVLIDEENRRYFKQQEIT+FR+PEN Sbjct: 246 RLFLGGFDLTPTFRDVNKKFSTRYYLNLVLIDEENRRYFKQQEITIFRIPEN 297