BLASTX nr result
ID: Phellodendron21_contig00031591
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00031591 (526 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO57318.1 hypothetical protein CISIN_1g0126252mg, partial [Citr... 52 8e-06 >KDO57318.1 hypothetical protein CISIN_1g0126252mg, partial [Citrus sinensis] KDO57319.1 hypothetical protein CISIN_1g0126252mg, partial [Citrus sinensis] KDO57320.1 hypothetical protein CISIN_1g0126252mg, partial [Citrus sinensis] Length = 105 Score = 52.4 bits (124), Expect = 8e-06 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = -3 Query: 524 NSAFTILRTSPEKHMKGFVPCKKRTVVERDDQSSPI-RGKEQR 399 NSAF+++RT +KHMKGFVP KKR +VERD+Q S + G++QR Sbjct: 62 NSAFSVIRTRTDKHMKGFVPYKKR-IVERDNQLSAVGNGRDQR 103