BLASTX nr result
ID: Phellodendron21_contig00031551
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00031551 (411 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAV92821.1 hypothetical protein PTTG_02080 [Puccinia triticina 1... 67 2e-10 KNF05063.1 hypothetical protein PSTG_01694 [Puccinia striiformis... 59 1e-07 KNZ51179.1 uncharacterized protein VP01_405g9 [Puccinia sorghi] 59 2e-07 XP_007408356.1 hypothetical protein MELLADRAFT_116047 [Melampsor... 55 4e-06 >OAV92821.1 hypothetical protein PTTG_02080 [Puccinia triticina 1-1 BBBD Race 1] Length = 315 Score = 67.0 bits (162), Expect = 2e-10 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = -3 Query: 394 LNVCLLWNKDGKTTWVPNSVAREKLPQKMLDFYENHLQFA 275 +NVCLLW K+G+ +WV N VAR+KLPQKMLDFYE+HLQF+ Sbjct: 273 INVCLLW-KNGRVSWVSNEVARDKLPQKMLDFYEDHLQFS 311 >KNF05063.1 hypothetical protein PSTG_01694 [Puccinia striiformis f. sp. tritici PST-78] Length = 321 Score = 58.9 bits (141), Expect = 1e-07 Identities = 24/41 (58%), Positives = 33/41 (80%) Frame = -3 Query: 394 LNVCLLWNKDGKTTWVPNSVAREKLPQKMLDFYENHLQFAA 272 + VCL W K GK TW+ N +AR+KLPQ+++DFYE+HLQF + Sbjct: 279 MRVCLSW-KCGKVTWLSNKIARDKLPQRLIDFYEDHLQFTS 318 >KNZ51179.1 uncharacterized protein VP01_405g9 [Puccinia sorghi] Length = 374 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -3 Query: 394 LNVCLLWNKDGKTTWVPNSVAREKLPQKMLDFYEN 290 +NVCLLW K+G+ +WV N +AREKLPQKMLDFYE+ Sbjct: 334 INVCLLW-KNGRASWVSNKIAREKLPQKMLDFYED 367 >XP_007408356.1 hypothetical protein MELLADRAFT_116047 [Melampsora larici-populina 98AG31] EGG08158.1 hypothetical protein MELLADRAFT_116047 [Melampsora larici-populina 98AG31] Length = 301 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/43 (62%), Positives = 31/43 (72%) Frame = -3 Query: 403 AGDLNVCLLWNKDGKTTWVPNSVAREKLPQKMLDFYENHLQFA 275 +G++ V LL K KT WV NS AREK+P MLDFYE HLQFA Sbjct: 257 SGEIRV-LLQLKSNKTAWVSNSAAREKVPMVMLDFYEKHLQFA 298