BLASTX nr result
ID: Phellodendron21_contig00031276
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00031276 (582 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP20466.1 unnamed protein product [Coffea canephora] 66 2e-11 XP_013453607.1 hypothetical protein MTR_5g024973 [Medicago trunc... 66 5e-11 XP_007161701.1 hypothetical protein PHAVU_001G090900g [Phaseolus... 63 3e-10 KJB22935.1 hypothetical protein B456_004G074800 [Gossypium raimo... 63 1e-09 ABN09822.1 hypothetical protein MtrDRAFT_AC167711g28v2 [Medicago... 63 2e-09 XP_013447472.1 hypothetical protein MTR_7g007390 [Medicago trunc... 62 8e-09 XP_003624604.2 transmembrane protein, putative [Medicago truncat... 63 2e-08 KVH94195.1 Extracellular ligand-binding receptor [Cynara cardunc... 63 3e-08 OMO66684.1 hypothetical protein COLO4_30452 [Corchorus olitorius] 56 2e-07 ABN09802.1 hypothetical protein MtrDRAFT_AC167711g44v2 [Medicago... 54 1e-06 XP_003624941.1 hypothetical protein MTR_7g089250 [Medicago trunc... 54 2e-06 XP_003624943.1 hypothetical protein MTR_7g089270 [Medicago trunc... 54 3e-06 AAT46037.1 At5g54075 [Arabidopsis thaliana] AAT70480.1 At5g54075... 51 6e-06 ONH90710.1 hypothetical protein PRUPE_8G070600 [Prunus persica] 52 9e-06 >CDP20466.1 unnamed protein product [Coffea canephora] Length = 63 Score = 66.2 bits (160), Expect = 2e-11 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +2 Query: 299 RLRRTVNHALITRS*FIHQT*YPVSLELKDTEVRAYRTDP 418 R R VNHAL+ RS FIHQT +PVSLELKDTEVRAYRTDP Sbjct: 19 RATRAVNHALVKRSYFIHQTWFPVSLELKDTEVRAYRTDP 58 >XP_013453607.1 hypothetical protein MTR_5g024973 [Medicago truncatula] KEH27642.1 hypothetical protein MTR_5g024973 [Medicago truncatula] Length = 96 Score = 66.2 bits (160), Expect = 5e-11 Identities = 35/50 (70%), Positives = 38/50 (76%) Frame = +2 Query: 269 ERSSTASVIRRLRRTVNHALITRS*FIHQT*YPVSLELKDTEVRAYRTDP 418 ERSSTA + VNHALITRS FIHQT PVSLE+KDT VR+YRTDP Sbjct: 13 ERSSTAEDDAHIILAVNHALITRSWFIHQTYVPVSLEIKDTVVRSYRTDP 62 >XP_007161701.1 hypothetical protein PHAVU_001G090900g [Phaseolus vulgaris] ESW33695.1 hypothetical protein PHAVU_001G090900g [Phaseolus vulgaris] Length = 65 Score = 63.2 bits (152), Expect = 3e-10 Identities = 36/54 (66%), Positives = 38/54 (70%), Gaps = 4/54 (7%) Frame = +2 Query: 269 ERSSTASVIR----RLRRTVNHALITRS*FIHQT*YPVSLELKDTEVRAYRTDP 418 ERSSTA + T+NH LIT S FIHQT PVSLELKDTEVRAYRTDP Sbjct: 7 ERSSTAKDASNPEDKTHLTINHGLITGSWFIHQTSDPVSLELKDTEVRAYRTDP 60 >KJB22935.1 hypothetical protein B456_004G074800 [Gossypium raimondii] Length = 100 Score = 62.8 bits (151), Expect = 1e-09 Identities = 31/42 (73%), Positives = 33/42 (78%) Frame = -3 Query: 436 SRPYLNRICSIGSYLCILEF*GDRISSLVDES*PCDQSVING 311 +RPYLNRICSIGSYLC L+F DRI SLVDE CD SVI G Sbjct: 12 ARPYLNRICSIGSYLCFLKFKRDRIPSLVDEPRLCDLSVITG 53 >ABN09822.1 hypothetical protein MtrDRAFT_AC167711g28v2 [Medicago truncatula] Length = 119 Score = 62.8 bits (151), Expect = 2e-09 Identities = 41/78 (52%), Positives = 46/78 (58%), Gaps = 1/78 (1%) Frame = +2 Query: 188 RVKMFAKRIESLSDNRVTTPARENSS*ERSSTASVIRRLR-RTVNHALITRS*FIHQT*Y 364 R K K E D+RVTTP R + ST R RTVNHALITRS + Q Sbjct: 37 RKKKRKKGGEICQDSRVTTPTRLAENDHLQSTHDDSRGSHHRTVNHALITRSQILIQIYV 96 Query: 365 PVSLELKDTEVRAYRTDP 418 PVSLE+KDT VR+YRTDP Sbjct: 97 PVSLEIKDTVVRSYRTDP 114 >XP_013447472.1 hypothetical protein MTR_7g007390 [Medicago truncatula] KEH21553.1 hypothetical protein MTR_7g007390 [Medicago truncatula] Length = 142 Score = 61.6 bits (148), Expect = 8e-09 Identities = 33/49 (67%), Positives = 36/49 (73%) Frame = +2 Query: 269 ERSSTASVIRRLRRTVNHALITRS*FIHQT*YPVSLELKDTEVRAYRTD 415 ERSSTA + VNHALITRS FIHQT PVSLE+KDT VR+YR D Sbjct: 30 ERSSTAEDDAHIIMAVNHALITRSWFIHQTYVPVSLEIKDTVVRSYRID 78 >XP_003624604.2 transmembrane protein, putative [Medicago truncatula] AES80822.2 transmembrane protein, putative [Medicago truncatula] Length = 263 Score = 62.8 bits (151), Expect = 2e-08 Identities = 41/78 (52%), Positives = 46/78 (58%), Gaps = 1/78 (1%) Frame = +2 Query: 188 RVKMFAKRIESLSDNRVTTPARENSS*ERSSTASVIRRLR-RTVNHALITRS*FIHQT*Y 364 R K K E D+RVTTP R + ST R RTVNHALITRS + Q Sbjct: 41 RKKKRKKGGEICQDSRVTTPTRLAENDHLQSTHDDSRGSHHRTVNHALITRSQILIQIYV 100 Query: 365 PVSLELKDTEVRAYRTDP 418 PVSLE+KDT VR+YRTDP Sbjct: 101 PVSLEIKDTVVRSYRTDP 118 >KVH94195.1 Extracellular ligand-binding receptor [Cynara cardunculus var. scolymus] Length = 2525 Score = 63.2 bits (152), Expect = 3e-08 Identities = 32/47 (68%), Positives = 34/47 (72%) Frame = -3 Query: 445 DFRSRPYLNRICSIGSYLCILEF*GDRISSLVDES*PCDQSVINGSP 305 D +RPYLNRICSIGSYLCIL+ DR LVDE PC QSVIN P Sbjct: 859 DGEARPYLNRICSIGSYLCILDSYEDRNPCLVDEPEPCCQSVINRDP 905 >OMO66684.1 hypothetical protein COLO4_30452 [Corchorus olitorius] Length = 85 Score = 56.2 bits (134), Expect = 2e-07 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = +2 Query: 296 RRLRRTVNHALITRS*FIHQT*YPVSLELKDTEVRAYRTDP 418 R ++ VNHALITRS I+QT PVS LKDTEVRAYRTDP Sbjct: 16 RGIKEAVNHALITRSWSINQTRDPVSFVLKDTEVRAYRTDP 56 >ABN09802.1 hypothetical protein MtrDRAFT_AC167711g44v2 [Medicago truncatula] Length = 83 Score = 54.3 bits (129), Expect = 1e-06 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = +2 Query: 296 RRLRRTVNHALITRS*FIHQT*YPVSLELKDTEVRAYRTDP 418 R RTVNHALITRS + Q PVSLE+KDT VR+YRTDP Sbjct: 38 RSHHRTVNHALITRSQILIQIYVPVSLEIKDTVVRSYRTDP 78 >XP_003624941.1 hypothetical protein MTR_7g089250 [Medicago truncatula] AES81159.1 hypothetical protein MTR_7g089250 [Medicago truncatula] Length = 93 Score = 53.9 bits (128), Expect = 2e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +2 Query: 311 TVNHALITRS*FIHQT*YPVSLELKDTEVRAYRTDP 418 +VNHALI RS FI QT PVSLE+KDT VR+YRTDP Sbjct: 20 SVNHALIARSSFIIQTYVPVSLEIKDTVVRSYRTDP 55 >XP_003624943.1 hypothetical protein MTR_7g089270 [Medicago truncatula] AES81161.1 hypothetical protein MTR_7g089270 [Medicago truncatula] Length = 95 Score = 53.5 bits (127), Expect = 3e-06 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +2 Query: 314 VNHALITRS*FIHQT*YPVSLELKDTEVRAYRTDP 418 VNHALI RS FI QT PVSLE+KDT VR+YRTDP Sbjct: 56 VNHALIARSSFIIQTYVPVSLEIKDTVVRSYRTDP 90 >AAT46037.1 At5g54075 [Arabidopsis thaliana] AAT70480.1 At5g54075 [Arabidopsis thaliana] Length = 39 Score = 51.2 bits (121), Expect = 6e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 436 SRPYLNRICSIGSYLCILEF*GDRISSLVDE 344 SRPYLNRICSIGSYLC L+F DR +LVDE Sbjct: 8 SRPYLNRICSIGSYLCFLDFSRDRPLTLVDE 38 >ONH90710.1 hypothetical protein PRUPE_8G070600 [Prunus persica] Length = 86 Score = 52.0 bits (123), Expect(2) = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 5/65 (7%) Frame = -1 Query: 399 RTSVSLSSKETGYQVWWMNHDR-----VIRA*LTVLLNLLITEAVEDRSQLEFSLAGVVT 235 RTSVSL SKETG WWMNHD VIR L+ +FSL+GVVT Sbjct: 21 RTSVSLISKETGIPTWWMNHDHPCDQSVIRIVLS-----------------QFSLSGVVT 63 Query: 234 RLSDR 220 RLSDR Sbjct: 64 RLSDR 68 Score = 25.0 bits (53), Expect(2) = 9e-06 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 443 LQITTLLKQDLFY 405 L++TTLL QDLFY Sbjct: 6 LEVTTLLGQDLFY 18