BLASTX nr result
ID: Phellodendron21_contig00031212
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00031212 (487 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007415832.1 hypothetical protein MELLADRAFT_79114 [Melampsora... 55 7e-06 >XP_007415832.1 hypothetical protein MELLADRAFT_79114 [Melampsora larici-populina 98AG31] EGG00984.1 hypothetical protein MELLADRAFT_79114 [Melampsora larici-populina 98AG31] Length = 394 Score = 55.1 bits (131), Expect = 7e-06 Identities = 32/71 (45%), Positives = 42/71 (59%), Gaps = 1/71 (1%) Frame = -3 Query: 485 GGWSPPLESFRPVLSDQVSNMLPLVSQELETG-EAEDTLRQDAIFKLDNFVPRLKRRREV 309 GGWSPP+E++ P+L+D + PL Q E + ED ++I PRLKRRREV Sbjct: 317 GGWSPPVETWSPILTDLDDSFPPLFFQSSEAPVKKEDVQVPESII----ISPRLKRRREV 372 Query: 308 LLGIETAGKGP 276 LLGI+T P Sbjct: 373 LLGIDTTKINP 383