BLASTX nr result
ID: Phellodendron21_contig00031203
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00031203 (293 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003331058.2 hypothetical protein PGTG_13021 [Puccinia gramini... 56 4e-07 >XP_003331058.2 hypothetical protein PGTG_13021 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP86639.2 hypothetical protein PGTG_13021 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 563 Score = 56.2 bits (134), Expect = 4e-07 Identities = 37/106 (34%), Positives = 54/106 (50%), Gaps = 17/106 (16%) Frame = +3 Query: 3 CHSTFVEEISALTS-SDDHPSQWTSEDTRIPPGPARQTYPSPPIPSTRQRYEEEQ----- 164 CHS+FVEE+S+ +S SD P+ W+ + Q SPPIPSTRQRYE++Q Sbjct: 35 CHSSFVEELSSSSSNSDPQPNHWSHSHHHFID--SFQDDDSPPIPSTRQRYEQQQNTRHQ 92 Query: 165 -------RSAEYQPNFPEMLGPLLNLFGIHNF----GHNPNPASER 269 R +Q F ++ PL+N+ + H+ P+S R Sbjct: 93 QQQQQANRQPLHQAPFINLIDPLINILSAPSIPDPADHDQPPSSSR 138