BLASTX nr result
ID: Phellodendron21_contig00031121
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00031121 (283 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABY40731.1 FERONIA receptor-like kinase, partial [Citrus trifoli... 79 3e-15 KDP21852.1 hypothetical protein JCGZ_00639 [Jatropha curcas] 79 4e-15 XP_012091030.1 PREDICTED: receptor-like protein kinase FERONIA [... 79 4e-15 OAY41700.1 hypothetical protein MANES_09G122900 [Manihot esculenta] 79 4e-15 KDO64141.1 hypothetical protein CISIN_1g036624mg [Citrus sinensis] 79 4e-15 XP_006429617.1 hypothetical protein CICLE_v10011034mg [Citrus cl... 79 4e-15 XP_008364006.1 PREDICTED: LOW QUALITY PROTEIN: receptor-like pro... 78 9e-15 XP_008370279.1 PREDICTED: receptor-like protein kinase FERONIA [... 78 9e-15 XP_009370899.1 PREDICTED: receptor-like protein kinase FERONIA [... 78 9e-15 GAV91330.1 Pkinase_Tyr domain-containing protein/Malectin_like d... 77 1e-14 OIW01375.1 hypothetical protein TanjilG_12915 [Lupinus angustifo... 77 1e-14 KVH95034.1 Concanavalin A-like lectin/glucanase, subgroup [Cynar... 77 1e-14 XP_010098025.1 Receptor-like protein kinase FERONIA [Morus notab... 77 1e-14 XP_017646177.1 PREDICTED: receptor-like protein kinase FERONIA [... 77 1e-14 XP_016694079.1 PREDICTED: receptor-like protein kinase FERONIA [... 77 1e-14 XP_017252564.1 PREDICTED: receptor-like protein kinase FERONIA [... 77 1e-14 XP_012478290.1 PREDICTED: receptor-like protein kinase FERONIA [... 77 1e-14 XP_015897910.1 PREDICTED: receptor-like protein kinase FERONIA [... 77 1e-14 XP_002528704.2 PREDICTED: receptor-like protein kinase FERONIA [... 77 1e-14 OMP10174.1 hypothetical protein COLO4_04754 [Corchorus olitorius] 77 1e-14 >ABY40731.1 FERONIA receptor-like kinase, partial [Citrus trifoliata] Length = 447 Score = 79.0 bits (193), Expect = 3e-15 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 DSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 119 DSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 409 DSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 447 >KDP21852.1 hypothetical protein JCGZ_00639 [Jatropha curcas] Length = 652 Score = 79.0 bits (193), Expect = 4e-15 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 DSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 119 DSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 614 DSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 652 >XP_012091030.1 PREDICTED: receptor-like protein kinase FERONIA [Jatropha curcas] Length = 891 Score = 79.0 bits (193), Expect = 4e-15 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 DSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 119 DSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 853 DSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 891 >OAY41700.1 hypothetical protein MANES_09G122900 [Manihot esculenta] Length = 893 Score = 79.0 bits (193), Expect = 4e-15 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 DSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 119 DSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 855 DSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 893 >KDO64141.1 hypothetical protein CISIN_1g036624mg [Citrus sinensis] Length = 893 Score = 79.0 bits (193), Expect = 4e-15 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 DSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 119 DSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 855 DSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 893 >XP_006429617.1 hypothetical protein CICLE_v10011034mg [Citrus clementina] XP_006481221.1 PREDICTED: receptor-like protein kinase FERONIA [Citrus sinensis] ESR42857.1 hypothetical protein CICLE_v10011034mg [Citrus clementina] Length = 895 Score = 79.0 bits (193), Expect = 4e-15 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 DSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 119 DSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 857 DSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 895 >XP_008364006.1 PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase FERONIA [Malus domestica] Length = 747 Score = 77.8 bits (190), Expect = 9e-15 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +3 Query: 3 DSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 119 DSRSTGMSMSIGGRSLAS+DSDGLTPSAVFSQIMNPKGR Sbjct: 709 DSRSTGMSMSIGGRSLASDDSDGLTPSAVFSQIMNPKGR 747 >XP_008370279.1 PREDICTED: receptor-like protein kinase FERONIA [Malus domestica] AQM55932.1 MRLK1 [Malus domestica] Length = 891 Score = 77.8 bits (190), Expect = 9e-15 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +3 Query: 3 DSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 119 DSRSTGMSMSIGGRSLAS+DSDGLTPSAVFSQIMNPKGR Sbjct: 853 DSRSTGMSMSIGGRSLASDDSDGLTPSAVFSQIMNPKGR 891 >XP_009370899.1 PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri] XP_009370904.1 PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri] Length = 892 Score = 77.8 bits (190), Expect = 9e-15 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +3 Query: 3 DSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 119 DSRSTGMSMSIGGRSLAS+DSDGLTPSAVFSQIMNPKGR Sbjct: 854 DSRSTGMSMSIGGRSLASDDSDGLTPSAVFSQIMNPKGR 892 >GAV91330.1 Pkinase_Tyr domain-containing protein/Malectin_like domain-containing protein [Cephalotus follicularis] Length = 808 Score = 77.4 bits (189), Expect = 1e-14 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +3 Query: 3 DSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 119 DSRS+GMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 770 DSRSSGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 808 >OIW01375.1 hypothetical protein TanjilG_12915 [Lupinus angustifolius] Length = 882 Score = 77.4 bits (189), Expect = 1e-14 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +3 Query: 3 DSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 119 DSRS+GMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 844 DSRSSGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 882 >KVH95034.1 Concanavalin A-like lectin/glucanase, subgroup [Cynara cardunculus var. scolymus] Length = 882 Score = 77.4 bits (189), Expect = 1e-14 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +3 Query: 3 DSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 119 DSRS+GMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 844 DSRSSGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 882 >XP_010098025.1 Receptor-like protein kinase FERONIA [Morus notabilis] EXB74408.1 Receptor-like protein kinase FERONIA [Morus notabilis] Length = 888 Score = 77.4 bits (189), Expect = 1e-14 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +3 Query: 3 DSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 119 DSRS+GMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 850 DSRSSGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 888 >XP_017646177.1 PREDICTED: receptor-like protein kinase FERONIA [Gossypium arboreum] Length = 889 Score = 77.4 bits (189), Expect = 1e-14 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +3 Query: 3 DSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 119 DSRS+GMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 851 DSRSSGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 889 >XP_016694079.1 PREDICTED: receptor-like protein kinase FERONIA [Gossypium hirsutum] Length = 889 Score = 77.4 bits (189), Expect = 1e-14 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +3 Query: 3 DSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 119 DSRS+GMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 851 DSRSSGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 889 >XP_017252564.1 PREDICTED: receptor-like protein kinase FERONIA [Daucus carota subsp. sativus] KZM95405.1 hypothetical protein DCAR_018647 [Daucus carota subsp. sativus] Length = 889 Score = 77.4 bits (189), Expect = 1e-14 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +3 Query: 3 DSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 119 DSRSTGMSMSIGG+SLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 851 DSRSTGMSMSIGGQSLASEDSDGLTPSAVFSQIMNPKGR 889 >XP_012478290.1 PREDICTED: receptor-like protein kinase FERONIA [Gossypium raimondii] KJB29840.1 hypothetical protein B456_005G120700 [Gossypium raimondii] Length = 889 Score = 77.4 bits (189), Expect = 1e-14 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +3 Query: 3 DSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 119 DSRS+GMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 851 DSRSSGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 889 >XP_015897910.1 PREDICTED: receptor-like protein kinase FERONIA [Ziziphus jujuba] Length = 891 Score = 77.4 bits (189), Expect = 1e-14 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +3 Query: 3 DSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 119 DSRS+GMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 853 DSRSSGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 891 >XP_002528704.2 PREDICTED: receptor-like protein kinase FERONIA [Ricinus communis] EEF33694.1 kinase, putative [Ricinus communis] Length = 891 Score = 77.4 bits (189), Expect = 1e-14 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +3 Query: 3 DSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 119 DSRS+GMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 853 DSRSSGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 891 >OMP10174.1 hypothetical protein COLO4_04754 [Corchorus olitorius] Length = 892 Score = 77.4 bits (189), Expect = 1e-14 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +3 Query: 3 DSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 119 DSRS+GMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 854 DSRSSGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 892