BLASTX nr result
ID: Phellodendron21_contig00030787
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00030787 (421 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003325088.2 hypothetical protein PGTG_06625 [Puccinia gramini... 71 1e-11 KNZ49852.1 hypothetical protein VP01_473g4 [Puccinia sorghi] 65 1e-09 XP_016274459.1 glycosyltransferase family 32 protein [Rhodotorul... 64 2e-09 CDR37522.1 RHTO0S02e15962g1_1 [Rhodotorula toruloides] 64 2e-09 KNF05441.1 hypothetical protein PSTG_01250 [Puccinia striiformis... 63 8e-09 >XP_003325088.2 hypothetical protein PGTG_06625 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP80669.2 hypothetical protein PGTG_06625 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 525 Score = 70.9 bits (172), Expect = 1e-11 Identities = 48/112 (42%), Positives = 57/112 (50%), Gaps = 22/112 (19%) Frame = -3 Query: 272 IVFYLGYITGSASLLGPISDLAISPPSTRFPLFRPHLSSAPPDIPFRIQL----PSPTPP 105 ++F +GY+ GS S P S + S RF L +P IPF + L PSP PP Sbjct: 161 LIFAIGYLLGSHSRSHPQS-IPASQQLARFVLRQPR-------IPFLVNLASSPPSPAPP 212 Query: 104 LPA----------KIPRYVHYVFGMTPDFGGK--------PFGFIHYAALQS 3 KIP VHYVFGM PDFGGK PFGFIHYA++QS Sbjct: 213 AQDHSLQVGRSKDKIPSIVHYVFGMAPDFGGKVVLNLISTPFGFIHYASIQS 264 >KNZ49852.1 hypothetical protein VP01_473g4 [Puccinia sorghi] Length = 546 Score = 65.1 bits (157), Expect = 1e-09 Identities = 43/103 (41%), Positives = 52/103 (50%), Gaps = 14/103 (13%) Frame = -3 Query: 269 VFYLGYITGSASLLGPISDLAISPPSTRFPLFRPHLSSAPPDIPFRIQLP----SPTPPL 102 +F +GY+ GS P S RF L +P IPF + L S L Sbjct: 155 IFAIGYLLGSQPRSIPASQQL-----ARFVLRQPR-------IPFLVNLSPSSQSAHSSL 202 Query: 101 P----------AKIPRYVHYVFGMTPDFGGKPFGFIHYAALQS 3 P +KIP +HYVFGM PDFGGKPFGFIHYA++QS Sbjct: 203 PDHSLQSTHSKSKIPSILHYVFGMAPDFGGKPFGFIHYASIQS 245 >XP_016274459.1 glycosyltransferase family 32 protein [Rhodotorula toruloides NP11] EMS23340.1 glycosyltransferase family 32 protein [Rhodotorula toruloides NP11] Length = 363 Score = 64.3 bits (155), Expect = 2e-09 Identities = 29/53 (54%), Positives = 35/53 (66%), Gaps = 6/53 (11%) Frame = -3 Query: 143 IPFRIQLPSP------TPPLPAKIPRYVHYVFGMTPDFGGKPFGFIHYAALQS 3 IPF + L +P +P L KIP Y+HYV+G+ PDFGGKPF FIHY L S Sbjct: 35 IPFHVPLAAPEGNSSFSPTLERKIPPYLHYVYGLAPDFGGKPFNFIHYVCLTS 87 >CDR37522.1 RHTO0S02e15962g1_1 [Rhodotorula toruloides] Length = 384 Score = 64.3 bits (155), Expect = 2e-09 Identities = 29/53 (54%), Positives = 35/53 (66%), Gaps = 6/53 (11%) Frame = -3 Query: 143 IPFRIQLPSP------TPPLPAKIPRYVHYVFGMTPDFGGKPFGFIHYAALQS 3 IPF + L +P +P L KIP Y+HYV+G+ PDFGGKPF FIHY L S Sbjct: 56 IPFHVPLAAPEGNSSFSPTLERKIPPYLHYVYGLAPDFGGKPFNFIHYVCLTS 108 >KNF05441.1 hypothetical protein PSTG_01250 [Puccinia striiformis f. sp. tritici PST-78] Length = 480 Score = 62.8 bits (151), Expect = 8e-09 Identities = 43/115 (37%), Positives = 56/115 (48%), Gaps = 26/115 (22%) Frame = -3 Query: 269 VFYLGYITG----------SASLLGPISDLAISPPS--TRFPLFRPHL------------ 162 +F +GY+ G S SL S L I+ RF L +P + Sbjct: 102 IFMIGYMLGGSQLHLNSDKSKSLSSSSSSLPITSTEQLARFVLRQPTIPFLVTINPTISS 161 Query: 161 --SSAPPDIPFRIQLPSPTPPLPAKIPRYVHYVFGMTPDFGGKPFGFIHYAALQS 3 SS +P + P+ P KIP +HYVFGM+ DFGGKPFGFIHYA++QS Sbjct: 162 DSSSVSNHLPLHSLVHHPSKP-NHKIPSIIHYVFGMSSDFGGKPFGFIHYASIQS 215