BLASTX nr result
ID: Phellodendron21_contig00030753
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00030753 (346 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KNF04881.1 hypothetical protein PSTG_01936 [Puccinia striiformis... 55 3e-06 >KNF04881.1 hypothetical protein PSTG_01936 [Puccinia striiformis f. sp. tritici PST-78] Length = 551 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/52 (53%), Positives = 35/52 (67%) Frame = -1 Query: 346 YRISDETVQRSSVEEALRANPFLLMYERVDEDCGIGQTASVRSPRELSWWEL 191 +RISDE VQ SS+++ALR+NPFLLMYERV E RELSW+ + Sbjct: 500 FRISDENVQLSSIDDALRSNPFLLMYERVFEPGHDDLAGKSLVGRELSWFHI 551