BLASTX nr result
ID: Phellodendron21_contig00030737
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00030737 (356 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007415456.1 hypothetical protein MELLADRAFT_73010 [Melampsora... 81 1e-15 >XP_007415456.1 hypothetical protein MELLADRAFT_73010 [Melampsora larici-populina 98AG31] EGG01355.1 hypothetical protein MELLADRAFT_73010 [Melampsora larici-populina 98AG31] Length = 478 Score = 81.3 bits (199), Expect = 1e-15 Identities = 45/89 (50%), Positives = 56/89 (62%), Gaps = 1/89 (1%) Frame = -3 Query: 351 SDSGFLPPKPLTSSCELTPLAKSNRLRTPFSVTPRPPTCAPQTSHTSSETATRIKL-QQH 175 SDSGFL PKP + S ++TP K + LR S TP P T + S S E A R+KL QQ Sbjct: 391 SDSGFLLPKPPSDS-DITPRGKPSWLRASLSQTPVPSTSVMEASRRSPEPAARLKLKQQQ 449 Query: 174 PQQSQNTKAQITTYVVPEKSFLQWIWADV 88 Q S+ TK Q+T Y VP+KSF+QWI D+ Sbjct: 450 HQDSKKTKVQLTDYSVPKKSFMQWIQGDI 478