BLASTX nr result
ID: Phellodendron21_contig00030540
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00030540 (421 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007418882.1 hypothetical protein MELLADRAFT_114031 [Melampsor... 69 6e-12 >XP_007418882.1 hypothetical protein MELLADRAFT_114031 [Melampsora larici-populina 98AG31] EGF97855.1 hypothetical protein MELLADRAFT_114031 [Melampsora larici-populina 98AG31] Length = 188 Score = 69.3 bits (168), Expect = 6e-12 Identities = 31/71 (43%), Positives = 37/71 (52%) Frame = +3 Query: 3 RKELEKPSVQFSXXXXXXXXXXXXXXXXXFKNWDRPHWDRRVISGVAIGVGVLFSSQGYF 182 R+E+ P QF F NWDR WDRR++S IG+G LF SQGY Sbjct: 116 RREIHSPQNQFGLLSVLNVGVLAGVGWMVFMNWDRKRWDRRIVSATVIGLGALFGSQGYL 175 Query: 183 GSLFYDQKKRS 215 G L Y QKKR+ Sbjct: 176 GGLLYSQKKRA 186