BLASTX nr result
ID: Phellodendron21_contig00030515
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00030515 (415 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO65984.1 hypothetical protein CISIN_1g012554mg [Citrus sinensis] 58 4e-07 XP_006479227.1 PREDICTED: putative G3BP-like protein isoform X1 ... 58 4e-07 XP_006443553.1 hypothetical protein CICLE_v10020020mg [Citrus cl... 58 4e-07 >KDO65984.1 hypothetical protein CISIN_1g012554mg [Citrus sinensis] Length = 461 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = +3 Query: 3 GYQRNDTDGRVNRTGRPPVNVTAKNEAPRVSAPA 104 GYQRND GRVNR GR VNVTAKN APRVSAPA Sbjct: 428 GYQRNDNGGRVNRAGRLTVNVTAKNVAPRVSAPA 461 >XP_006479227.1 PREDICTED: putative G3BP-like protein isoform X1 [Citrus sinensis] XP_006479229.1 PREDICTED: putative G3BP-like protein isoform X1 [Citrus sinensis] Length = 461 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = +3 Query: 3 GYQRNDTDGRVNRTGRPPVNVTAKNEAPRVSAPA 104 GYQRND GRVNR GR VNVTAKN APRVSAPA Sbjct: 428 GYQRNDNGGRVNRAGRLAVNVTAKNVAPRVSAPA 461 >XP_006443553.1 hypothetical protein CICLE_v10020020mg [Citrus clementina] ESR56793.1 hypothetical protein CICLE_v10020020mg [Citrus clementina] Length = 469 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = +3 Query: 3 GYQRNDTDGRVNRTGRPPVNVTAKNEAPRVSAPA 104 GYQRND GRVNR GR VNVTAKN APRVSAPA Sbjct: 436 GYQRNDNGGRVNRAGRLAVNVTAKNVAPRVSAPA 469