BLASTX nr result
ID: Phellodendron21_contig00030508
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00030508 (331 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006432435.1 hypothetical protein CICLE_v10000023mg [Citrus cl... 57 4e-07 KDO58851.1 hypothetical protein CISIN_1g000343mg [Citrus sinensis] 57 4e-07 XP_006465754.1 PREDICTED: E3 ubiquitin-protein ligase KEG isofor... 57 4e-07 XP_006432434.1 hypothetical protein CICLE_v10000023mg [Citrus cl... 57 4e-07 XP_016699935.1 PREDICTED: E3 ubiquitin-protein ligase KEG-like [... 56 7e-07 XP_012454004.1 PREDICTED: E3 ubiquitin-protein ligase KEG-like [... 56 7e-07 GAV69413.1 Ank domain-containing protein/Pkinase domain-containi... 55 1e-06 XP_017648830.1 PREDICTED: E3 ubiquitin-protein ligase KEG-like [... 54 3e-06 KHG22439.1 E3 ubiquitin-protein ligase KEG -like protein [Gossyp... 54 3e-06 XP_015894742.1 PREDICTED: E3 ubiquitin-protein ligase KEG [Zizip... 54 4e-06 XP_016677006.1 PREDICTED: E3 ubiquitin-protein ligase KEG-like [... 54 4e-06 XP_018818219.1 PREDICTED: E3 ubiquitin-protein ligase KEG isofor... 54 6e-06 XP_018818212.1 PREDICTED: E3 ubiquitin-protein ligase KEG isofor... 54 6e-06 XP_002263469.1 PREDICTED: E3 ubiquitin-protein ligase KEG isofor... 54 6e-06 XP_010659095.1 PREDICTED: E3 ubiquitin-protein ligase KEG isofor... 54 6e-06 CAN73176.1 hypothetical protein VITISV_007720 [Vitis vinifera] 54 6e-06 OMO87310.1 putative ankyrin-repeat containing protein [Corchorus... 53 8e-06 >XP_006432435.1 hypothetical protein CICLE_v10000023mg [Citrus clementina] ESR45675.1 hypothetical protein CICLE_v10000023mg [Citrus clementina] Length = 1227 Score = 57.0 bits (136), Expect = 4e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +1 Query: 1 KFQWREGRSWVGDPADIVLDESSSGRTGPS 90 KFQWREGR W+GDPADIVLDE SS RTG S Sbjct: 1198 KFQWREGRPWIGDPADIVLDECSSCRTGTS 1227 >KDO58851.1 hypothetical protein CISIN_1g000343mg [Citrus sinensis] Length = 1630 Score = 57.0 bits (136), Expect = 4e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +1 Query: 1 KFQWREGRSWVGDPADIVLDESSSGRTGPS 90 KFQWREGR W+GDPADIVLDE SS RTG S Sbjct: 1601 KFQWREGRPWIGDPADIVLDECSSCRTGTS 1630 >XP_006465754.1 PREDICTED: E3 ubiquitin-protein ligase KEG isoform X1 [Citrus sinensis] XP_006465755.1 PREDICTED: E3 ubiquitin-protein ligase KEG isoform X2 [Citrus sinensis] Length = 1652 Score = 57.0 bits (136), Expect = 4e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +1 Query: 1 KFQWREGRSWVGDPADIVLDESSSGRTGPS 90 KFQWREGR W+GDPADIVLDE SS RTG S Sbjct: 1623 KFQWREGRPWIGDPADIVLDECSSCRTGTS 1652 >XP_006432434.1 hypothetical protein CICLE_v10000023mg [Citrus clementina] ESR45674.1 hypothetical protein CICLE_v10000023mg [Citrus clementina] Length = 1652 Score = 57.0 bits (136), Expect = 4e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +1 Query: 1 KFQWREGRSWVGDPADIVLDESSSGRTGPS 90 KFQWREGR W+GDPADIVLDE SS RTG S Sbjct: 1623 KFQWREGRPWIGDPADIVLDECSSCRTGTS 1652 >XP_016699935.1 PREDICTED: E3 ubiquitin-protein ligase KEG-like [Gossypium hirsutum] Length = 1653 Score = 56.2 bits (134), Expect = 7e-07 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +1 Query: 1 KFQWREGRSWVGDPADIVLDESSSGRTGPS 90 KFQWREGR W+GDPADI+LD+SSSG T S Sbjct: 1624 KFQWREGRPWIGDPADIILDDSSSGTTNTS 1653 >XP_012454004.1 PREDICTED: E3 ubiquitin-protein ligase KEG-like [Gossypium raimondii] KJB73133.1 hypothetical protein B456_011G216900 [Gossypium raimondii] Length = 1653 Score = 56.2 bits (134), Expect = 7e-07 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +1 Query: 1 KFQWREGRSWVGDPADIVLDESSSGRTGPS 90 KFQWREGR W+GDPADI+LD+SSSG T S Sbjct: 1624 KFQWREGRPWIGDPADIILDDSSSGTTNTS 1653 >GAV69413.1 Ank domain-containing protein/Pkinase domain-containing protein/zf-C3HC4 domain-containing protein/Ank_2 domain-containing protein/Ank_4 domain-containing protein [Cephalotus follicularis] Length = 1622 Score = 55.5 bits (132), Expect = 1e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +1 Query: 1 KFQWREGRSWVGDPADIVLDESSSGRTGPS 90 KFQWREG+ W+GDPADIVLDES S RTG S Sbjct: 1593 KFQWREGKPWIGDPADIVLDESYSFRTGAS 1622 >XP_017648830.1 PREDICTED: E3 ubiquitin-protein ligase KEG-like [Gossypium arboreum] Length = 1392 Score = 54.3 bits (129), Expect = 3e-06 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = +1 Query: 1 KFQWREGRSWVGDPADIVLDESSSGRTGPS 90 KFQWREGR W+GDPADI+LD+SSSG S Sbjct: 1363 KFQWREGRPWIGDPADIILDDSSSGTANTS 1392 >KHG22439.1 E3 ubiquitin-protein ligase KEG -like protein [Gossypium arboreum] Length = 1651 Score = 54.3 bits (129), Expect = 3e-06 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = +1 Query: 1 KFQWREGRSWVGDPADIVLDESSSGRTGPS 90 KFQWREGR W+GDPADI+LD+SSSG S Sbjct: 1622 KFQWREGRPWIGDPADIILDDSSSGTANTS 1651 >XP_015894742.1 PREDICTED: E3 ubiquitin-protein ligase KEG [Ziziphus jujuba] Length = 1647 Score = 53.9 bits (128), Expect = 4e-06 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = +1 Query: 1 KFQWREGRSWVGDPADIVLDESSSGR 78 KF+WREGR WVGDPADIVLDE SSGR Sbjct: 1617 KFRWREGRPWVGDPADIVLDEPSSGR 1642 >XP_016677006.1 PREDICTED: E3 ubiquitin-protein ligase KEG-like [Gossypium hirsutum] Length = 1653 Score = 53.9 bits (128), Expect = 4e-06 Identities = 21/30 (70%), Positives = 25/30 (83%) Frame = +1 Query: 1 KFQWREGRSWVGDPADIVLDESSSGRTGPS 90 KFQWREGR W+GDPAD++LD+SSSG S Sbjct: 1624 KFQWREGRPWIGDPADVILDDSSSGTANTS 1653 >XP_018818219.1 PREDICTED: E3 ubiquitin-protein ligase KEG isoform X2 [Juglans regia] Length = 1348 Score = 53.5 bits (127), Expect = 6e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = +1 Query: 1 KFQWREGRSWVGDPADIVLDESSSGRTGPS 90 KF+WREGR W+GDPADIVLDESS G G S Sbjct: 1319 KFRWREGRPWIGDPADIVLDESSFGTMGNS 1348 >XP_018818212.1 PREDICTED: E3 ubiquitin-protein ligase KEG isoform X1 [Juglans regia] Length = 1631 Score = 53.5 bits (127), Expect = 6e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = +1 Query: 1 KFQWREGRSWVGDPADIVLDESSSGRTGPS 90 KF+WREGR W+GDPADIVLDESS G G S Sbjct: 1602 KFRWREGRPWIGDPADIVLDESSFGTMGNS 1631 >XP_002263469.1 PREDICTED: E3 ubiquitin-protein ligase KEG isoform X2 [Vitis vinifera] CBI35107.3 unnamed protein product, partial [Vitis vinifera] Length = 1631 Score = 53.5 bits (127), Expect = 6e-06 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = +1 Query: 1 KFQWREGRSWVGDPADIVLDESSSGRTG 84 KFQWREGR+W+GDPADIVLDE+ G TG Sbjct: 1602 KFQWREGRTWLGDPADIVLDETIPGTTG 1629 >XP_010659095.1 PREDICTED: E3 ubiquitin-protein ligase KEG isoform X1 [Vitis vinifera] Length = 1632 Score = 53.5 bits (127), Expect = 6e-06 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = +1 Query: 1 KFQWREGRSWVGDPADIVLDESSSGRTG 84 KFQWREGR+W+GDPADIVLDE+ G TG Sbjct: 1603 KFQWREGRTWLGDPADIVLDETIPGTTG 1630 >CAN73176.1 hypothetical protein VITISV_007720 [Vitis vinifera] Length = 1662 Score = 53.5 bits (127), Expect = 6e-06 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = +1 Query: 1 KFQWREGRSWVGDPADIVLDESSSGRTG 84 KFQWREGR+W+GDPADIVLDE+ G TG Sbjct: 1633 KFQWREGRTWLGDPADIVLDETIPGTTG 1660 >OMO87310.1 putative ankyrin-repeat containing protein [Corchorus olitorius] Length = 631 Score = 53.1 bits (126), Expect = 8e-06 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = +1 Query: 1 KFQWREGRSWVGDPADIVLDESSSG 75 KFQWREGR W+GDPADIVLD+SSSG Sbjct: 607 KFQWREGRPWLGDPADIVLDDSSSG 631