BLASTX nr result
ID: Phellodendron21_contig00030482
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00030482 (791 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO39902.1 hypothetical protein CISIN_1g000067mg [Citrus sinensis] 75 1e-11 KDO39903.1 hypothetical protein CISIN_1g000067mg [Citrus sinensis] 75 1e-11 XP_006447454.1 hypothetical protein CICLE_v10014009mg [Citrus cl... 75 1e-11 >KDO39902.1 hypothetical protein CISIN_1g000067mg [Citrus sinensis] Length = 2396 Score = 75.1 bits (183), Expect = 1e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +1 Query: 403 MGDGGVACMPLQQQQQHNSIMERFPISDKATVCVG 507 MGDGGVACMPLQQQQQHNSIMERFPISDK T+CVG Sbjct: 1 MGDGGVACMPLQQQQQHNSIMERFPISDKTTICVG 35 >KDO39903.1 hypothetical protein CISIN_1g000067mg [Citrus sinensis] Length = 2445 Score = 75.1 bits (183), Expect = 1e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +1 Query: 403 MGDGGVACMPLQQQQQHNSIMERFPISDKATVCVG 507 MGDGGVACMPLQQQQQHNSIMERFPISDK T+CVG Sbjct: 1 MGDGGVACMPLQQQQQHNSIMERFPISDKTTICVG 35 >XP_006447454.1 hypothetical protein CICLE_v10014009mg [Citrus clementina] XP_006447455.1 hypothetical protein CICLE_v10014009mg [Citrus clementina] XP_006469738.1 PREDICTED: histone-lysine N-methyltransferase ATXR3 [Citrus sinensis] ESR60694.1 hypothetical protein CICLE_v10014009mg [Citrus clementina] ESR60695.1 hypothetical protein CICLE_v10014009mg [Citrus clementina] Length = 2445 Score = 75.1 bits (183), Expect = 1e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +1 Query: 403 MGDGGVACMPLQQQQQHNSIMERFPISDKATVCVG 507 MGDGGVACMPLQQQQQHNSIMERFPISDK T+CVG Sbjct: 1 MGDGGVACMPLQQQQQHNSIMERFPISDKTTICVG 35