BLASTX nr result
ID: Phellodendron21_contig00030438
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00030438 (592 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007415400.1 hypothetical protein MELLADRAFT_73031 [Melampsora... 91 3e-18 >XP_007415400.1 hypothetical protein MELLADRAFT_73031 [Melampsora larici-populina 98AG31] EGG01299.1 hypothetical protein MELLADRAFT_73031 [Melampsora larici-populina 98AG31] Length = 334 Score = 90.5 bits (223), Expect = 3e-18 Identities = 41/63 (65%), Positives = 52/63 (82%) Frame = +3 Query: 12 LDFIGLHARSRFSYWNDVSNLLNTFNWKLNDEIDLKAKVAKEIRIELRRLAKLSVKKWTK 191 ++ I LH+ SRFS+WNDVSNL+NTF+WKLN+EID +A VAKEIR L RL K ++KKW K Sbjct: 272 IEAIVLHSLSRFSFWNDVSNLINTFHWKLNEEIDSRAPVAKEIRTALNRLVKSNLKKWHK 331 Query: 192 QGK 200 QG+ Sbjct: 332 QGR 334