BLASTX nr result
ID: Phellodendron21_contig00030339
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00030339 (373 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO68250.1 hypothetical protein CISIN_1g000376mg [Citrus sinensis] 59 1e-07 XP_006486649.1 PREDICTED: transcriptional elongation regulator M... 59 1e-07 XP_006422482.1 hypothetical protein CICLE_v10027678mg [Citrus cl... 59 1e-07 >KDO68250.1 hypothetical protein CISIN_1g000376mg [Citrus sinensis] Length = 1607 Score = 58.9 bits (141), Expect = 1e-07 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 372 SLLPSTDVEKRFEVLTEACEGNSSLLIVVEKLAKAS 265 S LPS DVEKRF +LTEACEGNSSLLI+VEKLA+ S Sbjct: 1572 SALPSNDVEKRFGLLTEACEGNSSLLIMVEKLARTS 1607 >XP_006486649.1 PREDICTED: transcriptional elongation regulator MINIYO [Citrus sinensis] Length = 1607 Score = 58.9 bits (141), Expect = 1e-07 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 372 SLLPSTDVEKRFEVLTEACEGNSSLLIVVEKLAKAS 265 S LPS DVEKRF +LTEACEGNSSLLI+VEKLA+ S Sbjct: 1572 SALPSNDVEKRFGLLTEACEGNSSLLIMVEKLARTS 1607 >XP_006422482.1 hypothetical protein CICLE_v10027678mg [Citrus clementina] ESR35722.1 hypothetical protein CICLE_v10027678mg [Citrus clementina] Length = 1607 Score = 58.9 bits (141), Expect = 1e-07 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 372 SLLPSTDVEKRFEVLTEACEGNSSLLIVVEKLAKAS 265 S LPS DVEKRF +LTEACEGNSSLLI+VEKLA+ S Sbjct: 1572 SALPSNDVEKRFGLLTEACEGNSSLLIMVEKLARTS 1607