BLASTX nr result
ID: Phellodendron21_contig00030312
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00030312 (295 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006430208.1 hypothetical protein CICLE_v10012077mg [Citrus cl... 72 8e-13 XP_006481779.1 PREDICTED: protein CIA1 [Citrus sinensis] KDO7039... 72 1e-12 XP_006430206.1 hypothetical protein CICLE_v10012077mg [Citrus cl... 72 1e-12 XP_015898791.1 PREDICTED: protein CIA1 [Ziziphus jujuba] 68 3e-11 OAY40864.1 hypothetical protein MANES_09G055600 [Manihot esculenta] 67 6e-11 XP_012066495.1 PREDICTED: probable cytosolic iron-sulfur protein... 67 6e-11 XP_002528743.1 PREDICTED: protein CIA1 [Ricinus communis] EEF336... 67 6e-11 OAY42898.1 hypothetical protein MANES_08G025000 [Manihot esculenta] 67 8e-11 XP_010101568.1 putative cytosolic iron-sulfur protein assembly p... 67 8e-11 OMO82242.1 hypothetical protein CCACVL1_12027 [Corchorus capsula... 66 1e-10 OMO68372.1 hypothetical protein COLO4_29739 [Corchorus olitorius] 66 1e-10 XP_002282694.1 PREDICTED: protein CIA1 [Vitis vinifera] CBI30292... 65 2e-10 KJB16624.1 hypothetical protein B456_002G240100 [Gossypium raimo... 64 2e-10 XP_018498569.1 PREDICTED: protein CIA1-like [Pyrus x bretschneid... 65 3e-10 ONH96164.1 hypothetical protein PRUPE_7G110600 [Prunus persica] 64 4e-10 XP_018813685.1 PREDICTED: protein CIA1-like [Juglans regia] 65 4e-10 KJB16623.1 hypothetical protein B456_002G240100 [Gossypium raimo... 64 4e-10 XP_018835731.1 PREDICTED: protein CIA1-like isoform X2 [Juglans ... 64 5e-10 GAV82440.1 WD40 domain-containing protein [Cephalotus follicularis] 64 5e-10 XP_016714898.1 PREDICTED: protein CIA1-like [Gossypium hirsutum] 64 5e-10 >XP_006430208.1 hypothetical protein CICLE_v10012077mg [Citrus clementina] ESR43448.1 hypothetical protein CICLE_v10012077mg [Citrus clementina] KDO70393.1 hypothetical protein CISIN_1g018675mg [Citrus sinensis] Length = 281 Score = 71.6 bits (174), Expect = 8e-13 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -1 Query: 295 HDMDVNSAQWSPGEHRLLASASDDGTVKIWELANTL 188 HDMDVNS QWSPGE RLLASASDDG +KIWELANTL Sbjct: 246 HDMDVNSVQWSPGERRLLASASDDGMIKIWELANTL 281 >XP_006481779.1 PREDICTED: protein CIA1 [Citrus sinensis] KDO70392.1 hypothetical protein CISIN_1g018675mg [Citrus sinensis] Length = 352 Score = 71.6 bits (174), Expect = 1e-12 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -1 Query: 295 HDMDVNSAQWSPGEHRLLASASDDGTVKIWELANTL 188 HDMDVNS QWSPGE RLLASASDDG +KIWELANTL Sbjct: 317 HDMDVNSVQWSPGERRLLASASDDGMIKIWELANTL 352 >XP_006430206.1 hypothetical protein CICLE_v10012077mg [Citrus clementina] XP_006430207.1 hypothetical protein CICLE_v10012077mg [Citrus clementina] ESR43446.1 hypothetical protein CICLE_v10012077mg [Citrus clementina] ESR43447.1 hypothetical protein CICLE_v10012077mg [Citrus clementina] Length = 352 Score = 71.6 bits (174), Expect = 1e-12 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -1 Query: 295 HDMDVNSAQWSPGEHRLLASASDDGTVKIWELANTL 188 HDMDVNS QWSPGE RLLASASDDG +KIWELANTL Sbjct: 317 HDMDVNSVQWSPGERRLLASASDDGMIKIWELANTL 352 >XP_015898791.1 PREDICTED: protein CIA1 [Ziziphus jujuba] Length = 353 Score = 67.8 bits (164), Expect = 3e-11 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 295 HDMDVNSAQWSPGEHRLLASASDDGTVKIWELA 197 HDMDVNS QWSPGE RLLASASDDGT+KIWELA Sbjct: 317 HDMDVNSVQWSPGEKRLLASASDDGTIKIWELA 349 >OAY40864.1 hypothetical protein MANES_09G055600 [Manihot esculenta] Length = 285 Score = 66.6 bits (161), Expect = 6e-11 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 295 HDMDVNSAQWSPGEHRLLASASDDGTVKIWELA 197 HDMD+NS QW PGE+RLLASASDDGT+KIWELA Sbjct: 250 HDMDINSVQWGPGENRLLASASDDGTIKIWELA 282 >XP_012066495.1 PREDICTED: probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog [Jatropha curcas] KDP42746.1 hypothetical protein JCGZ_23686 [Jatropha curcas] Length = 349 Score = 67.0 bits (162), Expect = 6e-11 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 295 HDMDVNSAQWSPGEHRLLASASDDGTVKIWELA 197 HDMD+NS QW PGE+RLLASASDDGTVKIWELA Sbjct: 314 HDMDINSVQWGPGENRLLASASDDGTVKIWELA 346 >XP_002528743.1 PREDICTED: protein CIA1 [Ricinus communis] EEF33655.1 WD-repeat protein, putative [Ricinus communis] Length = 349 Score = 67.0 bits (162), Expect = 6e-11 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -1 Query: 295 HDMDVNSAQWSPGEHRLLASASDDGTVKIWELA 197 HDMD+NS QW+PGE+RLLASASDDGT+KIWELA Sbjct: 314 HDMDINSVQWAPGENRLLASASDDGTIKIWELA 346 >OAY42898.1 hypothetical protein MANES_08G025000 [Manihot esculenta] Length = 349 Score = 66.6 bits (161), Expect = 8e-11 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 295 HDMDVNSAQWSPGEHRLLASASDDGTVKIWELA 197 HDMD+NS QW PGE+RLLASASDDGT+KIWELA Sbjct: 314 HDMDINSVQWGPGENRLLASASDDGTIKIWELA 346 >XP_010101568.1 putative cytosolic iron-sulfur protein assembly protein [Morus notabilis] EXB88707.1 putative cytosolic iron-sulfur protein assembly protein [Morus notabilis] Length = 353 Score = 66.6 bits (161), Expect = 8e-11 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 295 HDMDVNSAQWSPGEHRLLASASDDGTVKIWELAN 194 H+MDVNS QWSPGE RLLASASDDGT+KIWELA+ Sbjct: 317 HEMDVNSVQWSPGEKRLLASASDDGTIKIWELAS 350 >OMO82242.1 hypothetical protein CCACVL1_12027 [Corchorus capsularis] Length = 349 Score = 65.9 bits (159), Expect = 1e-10 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 295 HDMDVNSAQWSPGEHRLLASASDDGTVKIWELAN 194 HDMDVNS QW PGE RLLASASDDGT+KIWELA+ Sbjct: 314 HDMDVNSVQWFPGEKRLLASASDDGTIKIWELAS 347 >OMO68372.1 hypothetical protein COLO4_29739 [Corchorus olitorius] Length = 350 Score = 65.9 bits (159), Expect = 1e-10 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 295 HDMDVNSAQWSPGEHRLLASASDDGTVKIWELAN 194 HDMDVNS QW PGE RLLASASDDGT+KIWELA+ Sbjct: 315 HDMDVNSVQWFPGEKRLLASASDDGTIKIWELAS 348 >XP_002282694.1 PREDICTED: protein CIA1 [Vitis vinifera] CBI30292.3 unnamed protein product, partial [Vitis vinifera] Length = 344 Score = 65.5 bits (158), Expect = 2e-10 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 295 HDMDVNSAQWSPGEHRLLASASDDGTVKIWELAN 194 HDMD+NS QWS GE+RLLASASDDGT+KIWELA+ Sbjct: 309 HDMDINSVQWSSGENRLLASASDDGTIKIWELAS 342 >KJB16624.1 hypothetical protein B456_002G240100 [Gossypium raimondii] Length = 228 Score = 64.3 bits (155), Expect = 2e-10 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 295 HDMDVNSAQWSPGEHRLLASASDDGTVKIWEL 200 HDMDVNS QW PGE RLLASASDDGT+KIWEL Sbjct: 193 HDMDVNSVQWCPGEKRLLASASDDGTIKIWEL 224 >XP_018498569.1 PREDICTED: protein CIA1-like [Pyrus x bretschneideri] Length = 347 Score = 65.1 bits (157), Expect = 3e-10 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -1 Query: 295 HDMDVNSAQWSPGEHRLLASASDDGTVKIWELAN 194 HDMD+NS QWSPGE R+LASASDDGT+KIWEL + Sbjct: 313 HDMDINSVQWSPGEDRVLASASDDGTIKIWELTS 346 >ONH96164.1 hypothetical protein PRUPE_7G110600 [Prunus persica] Length = 278 Score = 64.3 bits (155), Expect = 4e-10 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 295 HDMDVNSAQWSPGEHRLLASASDDGTVKIWELAN 194 HDMD+NS QWSPGE R+LASA+DDGT+KIWEL + Sbjct: 243 HDMDINSVQWSPGEDRILASAADDGTIKIWELTS 276 >XP_018813685.1 PREDICTED: protein CIA1-like [Juglans regia] Length = 354 Score = 64.7 bits (156), Expect = 4e-10 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 295 HDMDVNSAQWSPGEHRLLASASDDGTVKIWELANT 191 HDMD+NS QWSPGE RLLASASDDG +KIWEL ++ Sbjct: 314 HDMDINSVQWSPGEKRLLASASDDGVIKIWELVSS 348 >KJB16623.1 hypothetical protein B456_002G240100 [Gossypium raimondii] Length = 293 Score = 64.3 bits (155), Expect = 4e-10 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 295 HDMDVNSAQWSPGEHRLLASASDDGTVKIWEL 200 HDMDVNS QW PGE RLLASASDDGT+KIWEL Sbjct: 258 HDMDVNSVQWCPGEKRLLASASDDGTIKIWEL 289 >XP_018835731.1 PREDICTED: protein CIA1-like isoform X2 [Juglans regia] Length = 348 Score = 64.3 bits (155), Expect = 5e-10 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 295 HDMDVNSAQWSPGEHRLLASASDDGTVKIWELAN 194 HDMD+NS QWS GE RLLASASDDGT+KIWELA+ Sbjct: 314 HDMDINSIQWSSGEKRLLASASDDGTIKIWELAS 347 >GAV82440.1 WD40 domain-containing protein [Cephalotus follicularis] Length = 349 Score = 64.3 bits (155), Expect = 5e-10 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 295 HDMDVNSAQWSPGEHRLLASASDDGTVKIWEL 200 HD+DVNS QWSPG++RLLASASDDGT+KIWEL Sbjct: 314 HDVDVNSVQWSPGDNRLLASASDDGTIKIWEL 345 >XP_016714898.1 PREDICTED: protein CIA1-like [Gossypium hirsutum] Length = 350 Score = 64.3 bits (155), Expect = 5e-10 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 295 HDMDVNSAQWSPGEHRLLASASDDGTVKIWEL 200 HDMDVNS QW PGE RLLASASDDGT+KIWEL Sbjct: 315 HDMDVNSVQWCPGEKRLLASASDDGTIKIWEL 346